Conserved Protein Domain Family
DUF3082

?
pfam11282: DUF3082 
Protein of unknown function (DUF3082)
This family of proteins has no known function.
Statistics
?
PSSM-Id: 402737
View PSSM: pfam11282
Aligned: 57 rows
Threshold Bit Score: 62.9378
Threshold Setting Gi: 147850722
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
EFN54291           81 VTPLQSFIGTAQAGVICYLLFQASTAVDAYFDRQNLPDitTQYTAHNVAVLVQTVCRGLVYLITFIFGANALGLAGLTIQ 160 Chlorella ...
jgi:Pse7367_3236   45 smvIQNLSGVLMAGAIAVGLYFFTNSVAVKLAQNPITS--SNTLAMRVSTTVRTFLLALGTGATMIFGVVALGIFLLTIQ 122 Pseudanaba...
jgi:Syn7502_01096  18 iSPISGIIGAVISAILAYGLYNFTLGVARKLALSPFQN--AQTLADRIGAAIRTILLAMGSGITIIFGVIAIGLVLLTIK 95  Synechococ...
Q46L56             32 KGPISFLSGSITSLSFSFLSLFISKKIVIYFSIHSPNY--SSPFAQSIASGFKTLIIGISFLATFTFGFIGLGLFLVFIR 109 Prochloroc...
Q7V7W2             29 KGPLSFLSGAITSGLFAWLCLILSQKTVTYFALHSPNY--SSAIAQSIASGFKTLIIGMCFLATFSFAFIGFGLTLVFIR 106 Prochloroc...
Q7VCH5             30 KGPLSFLSGAISSIFFSWLCFSLSKKVIVYFALHSPQY--SSQIAQSISSAIKTLAIGMCFLATFTFAFIGLGLTIVFIR 107 Prochloroc...
jgi:Cyagr_0462     12 KGPLSFLSGAITSGLLAWLSLGVSQRVVGWYVTHPPHF--DSAFAQSIATAMKTLMVGMCFLATFTFAFIGLGLFLVFIR 89  Cyanobium ...
WP_011933268       28 KGPLSFLSGSLTSLLLAWLSLGLSKGMVAYFAAHPPSF--SNAIAQSIASALKTLFTGMCFLATFSFAFIGLGLFLVFLR 105 Synechococ...
CBJ29167          130 vNPFYAILGAGGAAAMSFGSWKATLWLAQAYYSKPAEEs-DILAVARMTSFIKQAVVGLFALGAGIFGVTALGMGVMaai 208 Ectocarpus...
EED96533          159 VNPLVCIGGAAFAWACAGGLWFFTTYLGVLFASHPLET--DIYFIQRLTGVFRNAVMGLSSLASGFFGVVGIGIFLLGIR 236 Thalassios...
EFN54291          161 L 161 Chlorella variabilis
jgi:Pse7367_3236  123 E 123 Pseudanabaena sp. PCC 7367
jgi:Syn7502_01096  96 Q 96  Synechococcus sp. PCC 7502
Q46L56            110 S 110 Prochlorococcus marinus str. NATL2A
Q7V7W2            107 S 107 Prochlorococcus marinus str. MIT 9313
Q7VCH5            108 S 108 Prochlorococcus marinus
jgi:Cyagr_0462     90 S 90  Cyanobium gracile PCC 6307
WP_011933268      106 S 106 Synechococcus sp. WH 7803
CBJ29167          209 v 209 Ectocarpus siliculosus
EED96533          237 V 237 Thalassiosira pseudonana CCMP1335
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap