Conserved Protein Domain Family
Med24_N

?
pfam11277: Med24_N 
Mediator complex subunit 24 N-terminal
This subunit of the Mediator complex appears to be conserved only from insects to humans. It is essential for correct retinal development in fish. Subunit composition of the mediator contributes to the control of differentiation in the vertebrate CNS as there are divergent functions of the mediator subunits Crsp34/Med27, Trap100/Med24, and Crsp150/Med14.
Statistics
?
PSSM-Id: 402734
View PSSM: pfam11277
Aligned: 12 rows
Threshold Bit Score: 1176.4
Threshold Setting Gi: 0
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q7Q6D9         10 SKTTLLKlMLLRAWKERWTDCQWGINVKTILTRGVSGDVYNLADAIIQQAVVGSGANMLFLSYLKHSLCAHLISHAAVLN 89   African malar...
Q9VSF2          3 ENNKILQ-LIYVAWRERWTDSQWGINIKKVLPRGVSGDVYNLADCLMQQALIGSTANPLVLNYLKHSLCAHLVSHAAVIR 81   fruit fly
Q16X15         10 SKTTLLKlMLLRAWKERWTDCQWGINVKAVLTRGVSGDVYNLADCILQQAVVGSGANTLFLSYLKHSLCAHLISHAAVLK 89   yellow fever ...
EFN62777       78 SKTSSLKaLLLRAWRERWTDLQWGINIKTILPRGVSGDVHNLADCILQQALVGPGPNQLVLSYLKHSLSSQLVSYAAVLQ 157  Florida carpe...
1_pfamImport    1 SKTSSLKaLLLRAWRERWSDLQWGIHIKTILPRGVSGDVYNLADCILQQALVGPAPNQLVLSYLKHSLSSQLVSYASVLQ 80  
EEC12065        4 SKTSSIKsLLLQAWRERWTDVRWGINIKNVLPRGVSGDVYDLADCILQEALVGPGPNNLFLSYLTHCLSAQVVSYGAVLS 83   black-legged ...
4_pfamImport    1 -----LKhLIITAWKERWTEKKWSIHVKKLITS--SSDMFHLADVLVSQSFIGSSPNLLMLGYISYALDCGMLSYASVIS 73  
XP_018673004    6 AD---LKhLVITSWKERWSEKKWSIHVKKLMTS--PSDMLHVSDVLVSQSFIGSSPNALLLRYISYALECGLLSYASVIT 80   vase tunicate
Q2PW47          1 MKVVNLKqAILQAWKERWSDYQWAINIKKNCPKGATWDYLNLAEALLEQAMIGPSPNPLILSYLKYAISSQMVSYSSVLT 80   zebrafish
Q99K74          1 MKVVNLKqAILQAWKERWSDYQWAINMKKFFPKGATWDILNLAEALLEQAMIGPSPNPLILSYLKYAISSQMVSCSSVLT 80   house mouse
XP_004911859    1 MKLVNLKqAILQAWKERWSDYQWAINMKKFFPKGVTWDILNLAEALLDQAMIGPAPNPLILSYLKYAINSQMVSYSTVLT 80   tropical claw...
XP_008208388   13 SKTSSLKaLLLRAWRERWSDLQWGINIKTILPRGVSGDVHNLADCILQQALVGPGPNELVLSYLKHSLCSQLVSYAAVLQ 92   jewel wasp
Q7Q6D9         90 RIAKYDQYDKHHCLIALLDFLKSIIDGVTCRGK-QEEAI-LTKATVSLVHWLLQIYECVLQSYAEDST---LQPEEEEVV 164  African malar...
Q9VSF2         82 CIAKYDKLERVYCITALLEFLASIVDGVTCRIK-SEEAV-LPSSVVHLVYWLLQIFARTVQHYELYGE---ISAEQSYML 156  fruit fly
Q16X15         90 RISKYDHFEMHHCLIALLEFLESIIGGVTCRGK-QEEGL-LTKAMLSLVYWLMQIYEHAIETFSENRS---LTTEQQEVV 164  yellow fever ...
EFN62777      158 RISKYDAFHKPHCILSLLEFLESIQVGITCRGK-PEEDL-LAAAVLSIVHWLLQCYLHALTKTPQNNS---LIPNSNEL- 231  Florida carpe...
1_pfamImport   81 RIAKFDGFHKPHCISCLLEFIESIQSGITCRGK-PEEGI-LASAILNLVHWLLQCYQHAVSTNAEPTA---------DMI 149 
EEC12065       84 SIGRFQSFFKPPCILSLLQLLYSIQAKVTCHGN-EEECIaLCKAIVSVTHWLYMCMCHSISKIVELKQ----STEHGLIL 158  black-legged ...
4_pfamImport   74 AISKHEELSKIESTKGVYNLLQQCLQ-FVCNNKvTEDAMeLCFSLRIVLQWLLRNIEQYLKGVRDIYG-----SAAEELI 147 
XP_018673004   81 AVSKHEDLSKIESTKAVYGLLKDCLQ-VVCKTRlMEDAMeLCFSLRMVLKWLLQNIEQCLKRVWDMYG-----STAEEII 154  vase tunicate
Q2PW47         81 AISKFDDFSRELCVKSLLEIMDMFSNRLSCHGK-AEECIgLCRAMLCTVVWLLQGCAWYCERLRDPND---FSALESSL- 155  zebrafish
Q99K74         81 AISKFDDFSRDLCVQALLDIMDMFCDRLSCHGK-AEECIgLCRALLSALHWLLRCTAASAERLQEGLEagtPAPGEKQL- 158  house mouse
XP_004911859   81 AISKFDDFSRDLCIQALLEIMDMFCDNLSCHGK-AEECIgLCRALMSALNWLLRCSTFYTDKLKDMLD---PVAGENHL- 155  tropical claw...
XP_008208388   93 RISKYDAFHKPHCIASLLEFLEMIHVGITCRGK-PEEDL-LAAACLSIVHWLLQCYYYALTKVPQAPP---LAPQPSELM 167  jewel wasp
Q7Q6D9        165 QRVAVVLERIVENPFLLGVLSIGKCDDPELFIALQKRFNGISNLTLTTGYVanvgagnANSLTVTDCMRKLVLLEVDAL- 243  African malar...
Q9VSF2        157 DQTCVVIDRLSQQQFLLSMLYVGCHEELEICGRIRDKYATIKGSLTNSNFT-------LNAPQVEQQLQQLAFIEAKHL- 228  fruit fly
Q16X15        165 EKTANVLEKIVQSQFLLGVVFVGKFEDPELFGMLAKKCLEIENLTVKSGFVppv--vsQKNVTVNDYIRKVASIETETL- 241  yellow fever ...
EFN62777      232 DKPASILQQMLNSDFMCAMMYLAKYDDKDLYIDVAKKCQEIERFLKTSNQ--------KSAVPIEDSLKKLCNLEIESL- 302  Florida carpe...
1_pfamImport  150 QKPVSILHNMLNCDFLTAMLYLAKHDDIELYNEVVKKCQEIEELLTQHEHI-------ATAAPLHQTLTKICKLELGAT- 221 
EEC12065      159 EKACETLCFFSESTFLKSLLYIGKHEDSAVYSQLVQKQQELESKLSQSQGFniskdtlECALNLVRLVDDMPHISLSSC- 237  black-legged ...
4_pfamImport  148 KLNCQTLELIATQPRTAGLLTIARFAESGIWNHIETDLAVIKNTSGQHPMYgeistscHHVSQLSK-----CSIAQKPV- 221 
XP_018673004  155 KLNCDILKLIATKPRTSGLLIIARFAEGGVWSHIETDLAVIKNSSGQHPLHseisascHHVSQLSK-----CSISPKPV- 228  vase tunicate
Q2PW47        156 RACLERMANLLHSTKNRALVHIARLEEQASWTNVEQAVLKLTENLSAVTNPtlk-eslEECVSLVKSIPQMLCLQCDPP- 233  zebrafish
Q99K74        159 ALCLQCLEKTLSSTKNRALLHIAKLEEASSWTAIEHSLLKLGEILANLSNPqlr-sqaERCGTLIRSIPSMLSVHSEQL- 236  house mouse
XP_004911859  156 SMCLQRLESMLSSTKNRALIHIAKLEEPASWTSVEQSLLRLAESISLLPSVqlr-nqaEECVSLIRSIPSMLSVHSDQL- 233  tropical claw...
XP_008208388  168 DKPAYLLKELLASDFICAMLYSAKHDNKDLYIYIVKKCQEIEKEQQKSNT--------KCSIPIEDSLKKLCNLEIENIv 239  jewel wasp
Q7Q6D9        244 -EMRPFDgg---kVEPITYSLQPLIAIEVLLNPMCDTHQYVAQLINLKRLKGFTYARLYCELMRGCLIALNNVEGTAKES 319  African malar...
Q9VSF2        229 -EMQPLNpp--stLEKISCCVQPLLAVEVLLNPCKDTSYYVAELQMLQRLKKYSNTRLFYEIIRAGFLTLSNVADTSPDT 305  fruit fly
Q16X15        242 -EIKEFDgk---gVEPITYCMQPLIAIDILFNPNCDTQMYVLEFLSIQALKGFPLSRLYCEIIRACLTCLNNVSGTSRES 317  yellow fever ...
EFN62777      303 -SFEKIR------MESITHCLQPLFAVQVLLNPSTETAVFVNQLLMVQRLKSYTNERLYCEIIRACLMCLHNVTGTFKES 375  Florida carpe...
1_pfamImport  222 -SLTNISdrevdvSEPLTYCVQALLAVQVMINPSADTAHLANQLRLLQKLKGYRMSRLCCEVIRACLMSLNDVLGLTEET 300 
EEC12065      238 -VSGRVP------KQPLVCSLNANVAIEAVLNPASDIQASVDHLLLMKKLLNLSSAELYCEIIRACFMGLAN--GSSEDL 308  black-legged ...
4_pfamImport  222 -YKLQT-------SGAVYHSILTLILLEVEERKLTNVEGIVQQLMLLSNVHGLTTRKLIFRLIQACFMLYLDAVDTELEQ 293 
XP_018673004  229 -YKLPV-------SSTLCQSIMSLILLEVEERKLTNIEAIVQQLILLCNIHGLSTSNLIYHLIQTCFMGYLDSRGNDLEQ 300  vase tunicate
Q2PW47        234 -------------VHTTFPSVHAFIMLEGTMNLTGETQPLVEQLMMIKRMQRIPAPLFVLEIWKACFTGLIESPEGNEEL 300  zebrafish
Q99K74        237 -------------HKTGFPTIHALILLEGTMNLTGEMQPLVEQLMMVKRMQHIPTPLFVLEIWKACFVGLIESPEGTQEL 303  house mouse
XP_004911859  234 -------------QRNGFPTVHAVVMLEGTMNLTGDAQPLVEQMNTVKRMQRIPSHLFLLEVWKACIVGLIESPEGTEEL 300  tropical claw...
XP_008208388  240 sKFVKVD------AEPITYCLQPLLAVQNLVNPSTETSIYISQLHMIQRLKNYSNARLYCEVIRACMMCLHDVTGSLKES 313  jewel wasp
Q7Q6D9        320 LLCAFAFIKVPHILHQLHA----KTNGAEQQDe--aTGATYSVEVLEAFELLLQDTPVLDYMDMKCA-CNVVECLLKEMV 392  African malar...
Q9VSF2        306 MWGAFMFFKMPHIIKQLHA----LQRIPGEQP----PPADYIPELVEALELLIEDNLLLDFMDTKCS-CNMIEFLLNDWT 376  fruit fly
Q16X15        318 YICAFTFIKVPQIMRQIHL----QTRVLTPNDfe-dAKLDYSPDVVEAFELLLQDSAILDFMDAKCA-CNTVEYLLNEML 391  yellow fever ...
EFN62777      376 QWGAFTFLKVPLILKELHA----------ATLns-dEKFEYSQDILDAFELLLQFTPLLDIMDSTCS-CNYVECLLNELQ 443  Florida carpe...
1_pfamImport  301 KWGAFTFLKLPHILLSLTG----SNLVSSGKYf---TDGDYSQDVAEAVQLLIQFVPLVDLMDSPIS-SNCIEALLTELT 372 
EEC12065      309 KWPAFTFLKVPQLLLKIHSar--------------kDDRQWEEELEAGLMQLLNYTPLLDLTDSKCH-CDCLQYLLNELQ 373  black-legged ...
4_pfamImport  294 EWCAMVFLRLPKIILQTKR----TNYR--HKIsn-nKIAEFNSDLEDALKMMLKLDSLLDTIDQLREgMNCIQLFTEQLM 366 
XP_018673004  301 EWCAMVFLRLPKIMVQLKAqltgSDFESPSKLss-kKIAQFGVDLQEALKMLLKLDSLLDTIDQICDgINCLKLLTEQFV 379  vase tunicate
Q2PW47        301 KWTAFTFLKIPQVLLRLKK----YPQGEKTQ--------DFTEDVNVAFEYLLNLTPLLDKADQRCN-CDCLSLLLQECN 367  zebrafish
Q99K74        304 KWTAFTYLKIPQVLVKLKK----YFHGEK----------DFTEDVNCAFEFLLKLTPLLDKADQRCN-CDCTNFLLQECN 368  house mouse
XP_004911859  301 KWTAFTFLKIPQALAKLKK----LSPMEQ----------DFNEDMKCAFEYLLKLTPLLDKADQRCN-CDCVSLLLQECN 365  tropical claw...
XP_008208388  314 HWGGFTVLKLPQILKELHA----------STLsgenESFEYSQDVLDAFELLLRYTPLLDKMDIIWA-GNSVQFLLNELQ 382  jewel wasp
Q7Q6D9        393 KLQLLTDTHVKQLVALREPVTAGLHKLDaNSAPLTMM-LKFVFRVESPLAGILKAL-STdcSKVQDaLLAMLCQVLTGNS 470  African malar...
Q9VSF2        377 KQQLVNDVHVKKFASQREAASQLLKKCD-NGQQTPSN-INFIKRAEVPLSGVLKTL-CT--NKVQD-MVNVLCQVPVGNS 450  fruit fly
Q16X15        392 KHHLINEKYSKLIAAKRDGITSSLQKLDlNTNQHSI--VKFVLRAEPPLVGILKTL-SSdyNKVQEaLLGMLCQVLSGNS 468  yellow fever ...
EFN62777      444 KVNLVTEKQAKQISARREGVTAALQKLEpSNTPTSSI-PKVIIRAKPTLAGILKTL-NAdyTKIQEaLLSMLYHVLTGNS 521  Florida carpe...
1_pfamImport  373 KLKLLNETHISAYTASRDLVSSGLSRLD-SGSPTSTPiLKVIIRAQPTLQRILKTL-DAdyAKIQDaLPNVLCQVLNGKS 450 
EEC12065      374 KVELLTEAQAKALMHRRQANTQK-QNLArQGPQTSQAgATLILKAEPTVTSILKSL-DAdySKNQDgLLGILCHMITGRS 451  black-legged ...
4_pfamImport  367 KKDRINESFHQELNKLR---SEMMEGMPsNNGQERCLnPVILLKADSTIEQLVKLFsSAdfSAEPEnLLSTFAGMRTMSS 443 
XP_018673004  380 KRELITDAYHQDLQNIR---CSMIENMPvNNVKERCLnPVIILKAENNIDQLVKLLsSTdfS-EPErLLNTFAGMMSIRS 455  vase tunicate
Q2PW47        368 KLGLLSEANTATLTAKRSEDREHAPRLKtAENANIQPnPGLILRAEPTVTNILKTV-DAdhSKSPEgLLGVLGHMLSGKS 446  zebrafish
Q99K74        369 KQGLLSEVNFASLVGKRTADRD--PQLKsSENANIQPnPGLILRAEPTVTNILKTM-DAdhSKSPEgLLGVLGHMLSGKS 445  house mouse
XP_004911859  366 KLGLLSDQNLENLVAKRTADREQAPRMKsAENSTIQPnPGLILRAEPTVTNILKTM-DAdhSKSPEgLLGVLGHMLSGKS 444  tropical claw...
XP_008208388  383 KVNLVTEKQTIQISSRRDGLLTPLQKFDpEKSI-----RTVIMRAEPTLAGFLKTL-NAeyTKIQDaLLSIFFQVLSGNS 456  jewel wasp
Q7Q6D9        471 LDLVLSVASVEGKFKAFISGLLKCNDYAKQaTTAEIGKAPTTRSALFDVSFMILASIAQSYGSDVILAEGG----NS--- 543  African malar...
Q9VSF2        451 FELILSVATVEGRLKTFVSRLIQCNENSKP-VPGDLGKLCVIRSTLFDVSFLMLTSIVQTYGSDVVLSERG----DS--- 522  fruit fly
Q16X15        469 FELILSVATVEGKLKTFVAGLIKCNENSKQ-VPGEMGKPAMTRAALFDVSFLMLVFIVQNYGSEGVLTDGT----DS--- 540  yellow fever ...
EFN62777      522 FELMLAVATVEGKLKTFVAKLIKFNESSKQiNEPVPDKTAATRAMLFDVSFLMLCSIVQTYGSDVVLEEGG----DS--- 594  Florida carpe...
1_pfamImport  451 FELILSVASVEGKLRTFVSKLIKFNECAKS--------GSTARPILFDITFVMLCSIVQTNGSRVVFEEGDrdgeKS--- 519 
EEC12065      452 FELILSAAAATGKLNSFVKKLIKFNEYNKQ-ISGETTRNAQTRTLLFDITFLMLCHIVQNYGIHSVVFNEEt--rDS--- 525  black-legged ...
4_pfamImport  444 FNALTAAAATTGQLADFASVLINCNNVMKS-SSAETMKSAQIRAVLFDITFLMVCYMIKLYDKEAIIVSFNaqskDEipi 522 
XP_018673004  456 FSALIAAATTTGQLPAFANALIDCNDAMKS-CPAETSKNAQIRAVLFDITFLMVCYMIKLYGKETTVGSYIvrskEEtpi 534  vase tunicate
Q2PW47        447 LDLLLAAAAATGKLKSFARKFIKLNEFPKH-ISGEGSKSASVRALLFDISFLMLCHVVQTYGSEVILSDPSpsseTP--- 522  zebrafish
Q99K74        446 LDLLLAAAAATGKLKSFARKFINLNEFTTH-GSGESTKTASVRALLFDISFLMLCHVAQTYGSEVILSESSsgeeVP--- 521  house mouse
XP_004911859  445 LDLLLAAAAATGKLKSFARKFIQLNEFTRH-IGVESSKAANVRALLFDISFLMLCHVAQTYGSEMILSEGCpsgeMP--- 520  tropical claw...
XP_008208388  457 FELMLSVATVEGKLKIFVSRLIKFNEFSKQ-VGEVPGKTPTTRALLFEISFLMLCSIVQTYGPEIVLEEGG----DS--- 528  jewel wasp
Q7Q6D9        544 ---FFEKWVRDYMVERKKTKSPMTMVKQ-ADPMVLEELIMAMNNSEgmyvGLKASSLRWEDICYTIPALVHQVLMAWESE 619  African malar...
Q9VSF2        523 ---FFEKWVRECMVERNKLKNPRQILAL-CDDSIVDELLLSFSKPEa--sQLKPNNLSWQETCLNLPGVLHHVLIAWEQE 596  fruit fly
Q16X15        541 ---FFEKWVRECMVEKHKSKSPMNMVKL-CDQNKVDELIVSLNSPD----GLKATSLKWQEICANIPGLLYQVLLAWENE 612  yellow fever ...
EFN62777      595 ---FFEQWVYECMPERNKPKSPQKMLQS-VDPARVDALLAQINSPDp---DFKSSNLKWHVACQSAMGAVKELLCAWESG 667  Florida carpe...
1_pfamImport  520 ---FFERWAEECMIERGKPKCPDTMLKH-ADPVVVDALLAQLNSPQp---DLSNIGLGWDNICMSVAAAMKEVVIAWQQE 592 
EEC12065      526 ---FFTTWVPECLAEGGRYNCPEKMLAG-CDPAKVDLLLAQLMNNDn---DFMTNQVKWHEVCVNIPMAIKEILVAWEHG 598  black-legged ...
4_pfamImport  523 llhWANTWWLDQINQISSVKYE-------SDPSRVENLIQVLRNSQ----EFKLSMTKWNDICINLPQAVIELLIARQKG 591 
XP_018673004  535 llqWINIWWTDKITQISTLKSE-------PEPNRVENLIPVLRSSQ----EFKLSMTKWNDICMNLPQSMIELLTARQKG 603  vase tunicate
Q2PW47        523 ---FFETWLQTCMPEEGKTLNPDHPCFR-PESGKVESLVALLNSSS----EMKLVQMKWHEICLSTPAAILEVLNAWENG 594  zebrafish
Q99K74        522 ---FFETWMQTCMPEEGKILNPDHPCFR-PDSTKVESLVALLNNSS----EMKLVQMKWHEACLSISAAILEILNAWENG 593  house mouse
XP_004911859  521 ---FFESWMQTCMPGEGRVLNPDHPCFRhPDIAKVEALVALLNTST----EMKLAQTKWHEVCLSIPAAILEIHNAWENG 593  tropical claw...
XP_008208388  529 ---FFEQWVRDCMPLKDKPKSPYKMLQN-LDTTKVDMLLSQITSGDs---DLKSSNTNWQVSCQSAMGVAKELLYAWESG 601  jewel wasp
Q7Q6D9        620 SIAPLEIKKMLDGLKAY---FSTFAVCAASWLCAYMQMVRQDEQLKPMNMVQQLC-SALAgplADEWQQQDY-------- 687  African malar...
Q9VSF2        597 TLSSADVKSILDNIKRR---LFSFSVCATSFLCAYMYSVKETELLKPLNMIQQFL-APLT---SEELSSQEN-------- 661  fruit fly
Q16X15        613 TLSTGEIKKFLDSLKSR---FCCFSICATSWLCAYMQIIRQDELLKPMNMIQQFV-TNIS---SEEMMQQEY-------- 677  yellow fever ...
EFN62777      668 VLGAGDVKRALDGLRTA---ACCLPVCAAAWLCAYMSITHQDALLKPMNMVQHFL-TPLP---GDEMQDN---------- 730  Florida carpe...
1_pfamImport  593 ALSVTDVKRILDNMRQS---MCCLPICASAWLCSYMQILHQDALLKPMNMVQQFLsSPII---NEEGSQQDT-------- 658 
EEC12065      599 AISTDSVKMILDNVKSR---ICCLPVCISAWLCSYINVLHHQEQLKPMNMLQHFM-TPLS---TDASGNSEGggdrpipq 671  black-legged ...
4_pfamImport  592 AIQLSEVIRACCFIRDGcplAVTMSVIAAVARSARLVVAHKDH----IKVLSTLVeKS-----SVQSQSNMM-------- 654 
XP_018673004  604 IISITEVVRACTLIKDGcplSVTLSVMAAVARCARLVVSRNDH----IQVLSALTeKSPT---QVQSLSNMM-------- 668  vase tunicate
Q2PW47        595 VLSVEAVQKITDNIKGK---VCSMAICAVAWLVAHVRMLGLDEREKPQTMIRQLM-TPMS---GENTLQF---------- 657  zebrafish
Q99K74        594 VLAFESIQKITDNIKGK---VCSLAVCAVAWLVAHVRMLGLDEREKSLQMIRQLA-GPLY---SENTLQF---------- 656  house mouse
XP_004911859  594 VLSFEAIQKITDNIKGK---VCSLAVCAVAWLVAHVRMLGLDERDKSLQMIRQLG-SPMF---GDNTLQF---------- 656  tropical claw...
XP_008208388  602 VLSAADVKRALNGLRAA---SFCLPVCAAAWLCAYMSITHQESLLKPANMVQQFI-SPIA---NDEMQDN---------- 664  jewel wasp
Q7Q6D9        688 -----CKERFGLMGQIVRRMQQEFLRTPQVNPKlralfp--sqqqqhVVSHLPLEEQFEEAWKAIAERGWLPIETTFLLD 760  African malar...
Q9VSF2        662 -----AKERLALSYQIIRKMQHDVHPAPSTKSR--------------LISHSPLVEQFREVWRTVVDAGHLPVRAAQSLE 722  fruit fly
Q16X15        678 -----LKERLGLTVQIIRKMQIDFQRLPVASPKmrnql-----qsqsLVSQAPLEEQFEEVWKGVLEKGWLPIEATLALE 747  yellow fever ...
EFN62777      731 -----LKERSSLMFQIIRKMQYDVHPPTQSKTKvlsm-------shsIISRQPILEQLESVWQNINQRGWINIQATQSLE 798  Florida carpe...
1_pfamImport  659 -----FKERSTLMVHIIRKMQYDMHLATSSKMKvi----------tfIISKEPMSEELAEIWSGVQEKGWLNISATHALE 723 
EEC12065      672 ephslYKERSLLMTNIVKKMMYDLHPPQQSKLKgplv------ishgLTNKTPLWEIMDSVFSAAHARGWIDLRAIQSLD 745  black-legged ...
4_pfamImport  655 -----YNERYIFFQSLCETIVSDLLPSLKQDGSt-------------LDKNKLHSEVLQQTLSTTRKIGWINRDGIAKFS 716 
XP_018673004  669 -----YNERFVFFQSVSSSIMSDLLPEFEPKTLn-------------LDKT-LHCTLLKQTFIEANQVGWINHAIITKFL 729  vase tunicate
Q2PW47        658 -----YHERVVIMSSILEHMCADVFQQTGLSLRpavegqepipyrnlLPARLPIRQALQSQFRKVLEKGWVDSHAFHLFE 732  zebrafish
Q99K74        657 -----YNERVVIMNSILEHMCADVLQQTATQIKfpstgvdtmpywnlLPPKRPIKEVLTDIFAKVLEKGWVDSRSIHILD 731  house mouse
XP_004911859  657 -----YNERVIIMSSILDNMCAEVLQQTATQIKfsapgsepvpyihrLPPKKPIKEVLRGAFSSTLEKGWVDSRTLHVFD 731  tropical claw...
XP_008208388  665 -----YKERSSFMFQIIRKMQYDYSLPSQTKTKvltv-------shsITSKYPILEQLQQIWQGIYQRGWINIQATQSLE 732  jewel wasp
Q7Q6D9        761 TLLQSCGPAWLVEKLIGKLFVCKYVRDLNKTMDIIFAIMHLDIERCTIALLSQLVPMMLLNKaQTPDIVDPQSRVLAKLC 840  African malar...
Q9VSF2        723 SLLLAGGAAWLSTQLVEQLLACKYTRDMSRTMDVVFAVMHLDIEKTTEALLQYVVAPLILRR-QGEDINEPQSLVLARLC 801  fruit fly
Q16X15        748 NLLQSCGPFWLVDKLVQQIFHCKYIREMNKTMDIVFAIMHLDIERCTIALLSQLVPMMLLNKlQISEIVDPFSRVLAKLC 827  yellow fever ...
EFN62777      799 SLLNTGGSLWFVTNIVKEVLKYRYQEELDQAVDLAFAIFHLDIENCTLDLINHIIPQYLHNSlQNDELVEPQSSILAKLC 878  Florida carpe...
1_pfamImport  724 SLFMTAGPQWFVISLVKEIMKLRYKEELDRAVDLALAVFHLDIETCTDYLLTTVLPQYLHNSiLND-IVEPQSSALAKLC 802 
EEC12065      746 TLMCVGGPQWFCDTLVRQALKHDHLEDLHRAIDLSFGLFHIDIEQCALALLTQVLPSYLLWEtRQDSLTEPRGSALARLT 825  black-legged ...
4_pfamImport  717 ECFNMLGVFGFMRQAMKHILKETRLNEITTTVDIVFGIMRLDIISTTMYLLKHGIPDFLKQDsQ--PLASPLGRAIAKMA 794 
XP_018673004  730 DCYNMLGVCGFMRQTLNQILKETHLCGITNAVDIVFAVMRFDIVSTTMYLLKYGLPTFFKTNsR--PLAAPIGSAIAKLT 807  vase tunicate
Q2PW47        733 NLLHMGGVFWFTNNLVKELLKETRKEWASRVVELLYSIFCLDTQQITLTLLGHILPRLLTDPaHWHSLADPPGRALAKLS 812  zebrafish
Q99K74        732 TLLHMGGVYWFCNNLIKELLKETRKEHTLRAVQLLYSIFCLDMQQVTLVLLGHILPGLLTDSsKWHSLMDPPGTALAKLA 811  house mouse
XP_004911859  732 TLLHMGGVYWFCNNLVKELLRETRLEFALRAVELLYAIFCLDMQQLTLTLLGHVLPSLLTDSaKWHMLMDPPGRALAKLS 811  tropical claw...
XP_008208388  733 SLLKTGGPLWFVSNLVKELLKIQYQEELDRSLDLIFAILHLDIENSTLDLINNVLPQYLYNSlQGKKLIEPQSSALAKLC 812  jewel wasp
Q7Q6D9        841 VYCIIVTME-------TSLTATKKRTRGTas-----------------sELEDLDa-----lCTSAKLRKIeldgmgvgc 891  African malar...
Q9VSF2        802 VYCIISCLEsrkgngtSALTAMKKRSRSH--------------------DDEELA-------ANAAKVRKVigdgsdnss 854  fruit fly
Q16X15        828 VYCIVATME-------APAVPTKKRSRAAit-----------------aEGDELDt-----lCSTPKMRKIg-------- 870  yellow fever ...
EFN62777      879 VYCIFSTLEyi----nSNPYRGNNRKRVRre-----------------lDADELDp-----lSMSNKLLRL--------- 923  Florida carpe...
1_pfamImport  803 SYCIYAAWQsqssytrKRPLQEKSAADMAaelvlcynmpapadrlfswsDLSDL---------LPTKLLRL--------- 864 
EEC12065      826 VLTTFAALQvrtsqpsVGTQRGGHKRPHW--------------------DMELEEamdeskrVRPNKMRRGln------- 878  black-legged ...
4_pfamImport  795 VAGLDLALNesalqqkSQLPPSKRQNPFSqnv---------------alNRQ----------SGQHKVRRL--------- 840 
XP_018673004  808 VASLDIALNeitlqqkSLLPKSRKQNPMLqni---------------vfDKQ-------------QKVRRL--------- 850  vase tunicate
Q2PW47        813 VWCALSSYSshh--kgQASARQRKRHRE---------------------DIEDYTslfplddTQPSKLMRL--------- 860  zebrafish
Q99K74        812 VWCALSSYSsh---kgQASSRQKKRHRE---------------------DIEDYVslfpvedMQPSKLMRL--------- 858  house mouse
XP_004911859  812 VWCAMTSYStqn--kgQPSPRQRKRHRE---------------------DIEDYSslfplddTQQSKLMRL--------- 859  tropical claw...
XP_008208388  813 VYCIFSSLEys----nNSPQQTNSRKRARkd-----------------iDPDDMDi-----gMPAAKLLRL--------- 857  jewel wasp
Q7Q6D9        892 teaATGGASGTEFSLDSALEPTASAWTteaasiATLKEPLQSCLQTLFRTFAQHIATD-ELSPKVYFVFQFLSLLVESGR 970  African malar...
Q9VSF2        855 dftDTTTGAGLAALLGSTSTSELRTTP------LTLREPLQTSVQHIFAVFLQFVSGD-ELSPKAVFVYQFISLLVECGG 927  fruit fly
Q16X15        871 --sESCDSSSSDFMLEQVLAARDNP--------APLKEPLQGCLQTLFRTFSQYIVSD-ELSPKIFFMFQLLSLLVEVGK 939  yellow fever ...
EFN62777      924 ------NETGESIPMYGSQSPQVQSTSngqkseIILKDPLMTALNNLFTIFSFLAGRDgEISQQTHFIFQFLRLTVQCGK 997  Florida carpe...
1_pfamImport  865 ------EEGPMTLKGSASEQQQVQVPP--------LRPPLSNSLKIMFNSFSLITEHIpYISQQTHFVFRVLELLVTCGR 930 
EEC12065      879 -dsELLDDTPFALQCHSEENYRSL-------------DPLSKAVVDTMRLLM-VIASDsVISQRSVFPLLLFEQVVLCAG 943  black-legged ...
4_pfamImport  841 ----------------FSCSTEHDLsi----pgLTFDDPLVHILSEFIDVMWCSLEAN-THGPQSEFVLEFVKLSLQASP 899 
XP_018673004  851 -----------------FSQTEHDLPPpgstpgLPAEDPLIQVLSDFMDLLWNSMESN-EGGPQADFIFKFIKLSLESSS 912  vase tunicate
Q2PW47        861 ---LSSNEDENSMLSSPGDRSISSSLSasqlhtVNMRDPLNRVLANLFLLISSQLGSK-TAGPHTQFVQSFVEECVDCSE 936  zebrafish
Q99K74        859 ---LSSSDDDANILSSPTDRSMNSSLSasqlhtVNMRDPLNRVLANLFLLISSILGSR-TAGPHTQFVQWFMEECVGCLE 934  house mouse
XP_004911859  860 ---LSSNEEEHSVQANPVDRPMNSSLSasqihnISSKEPLNRVLANLFLLISSVLGAK-TAGAQTQFVQWFMEECVESLE 935  tropical claw...
XP_008208388  858 ------NEAIDANSMFSSSSPQAQGTSngq-ksIVLRDPLLSALNGLFTNFNFLAGRNgEVSQHTHFILQFLQLTVLCGK 930  jewel wasp
Q7Q6D9        971 ERIM-CVLKLLPNGLVQSLLKINaTDEMTVGLILRLYDLNTPSGRQFAMSDIC 1022 African malaria mosquito
Q9VSF2        928 ERVA-PVLRLLPNGLVQQLLKVLvTDDIKVGLISRLYDLRIQAGRLSAVSDLC 979  fruit fly
Q16X15        940 DRIK-PVLKLIPNGLIQNMMKINaTDDMTVGFILRLYDLNTASGRQFAMSDLC 991  yellow fever mosquito
EFN62777      998 DRTR-IVLQGMPQTLVPCLLKAL-PELFTTDILLRLYDIQTIIGRKATARDLC 1048 Florida carpenter ant
1_pfamImport  931 DQTR-PVLQDMPNTLVPSLLRAL-PNLFSTDLVLRLYDLTSPAGRKATASDLC 981 
EEC12065      944 DEAH-RVLQFAPLGLVPQLVRSM-PHLMSHQLVLALSSLQTSRARKVAARATC 994  black-legged tick
4_pfamImport  900 LLSR-TVKRLIPIPMIRELRYSLvNH--SRELLFAACDLGNPEIRKLAAHAVC 949 
XP_018673004  913 LLSR-TVKLHIPVPMLSKLRYPLaKD--SHVLLFAASDMGNEEIRKLAAHAIC 962  vase tunicate
Q2PW47        937 QGSRsSILQFMPFTMISELVKL--QSLAKPKTVLSITDLSLPLGRRMAAKAIA 987  zebrafish
Q99K74        935 QDSRgSILQFMPFTTVSELVKV--SAMSSPKVVLAITDLSLPLGRQVAAKAIA 985  house mouse
XP_004911859  936 LGGKgCILQFMPFSMVSELVKV--STLSSPKIVLAITDLTLPLGRRVAAKALT 986  tropical clawed frog
XP_008208388  931 DRAR-LVLQKMPQTLVPSLLKAL-PEFFTTDLLLRLYDVQTIMGRKAIARDLC 981  jewel wasp
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap