Conserved Protein Domain Family
DUF3074

?
pfam11274: DUF3074 
Protein of unknown function (DUF3074)
This eukaryotic family of proteins has no known function but appears to be part of the START superfamily.
Statistics
?
PSSM-Id: 402732
View PSSM: pfam11274
Aligned: 106 rows
Threshold Bit Score: 120.434
Threshold Setting Gi: 254580757
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
EGX53386          154 WFARRSVH--------------E---GIGFARFRKGLRREFEESLERrmgvgregggngnnngeemvipagVRGIGAERR 216 Arthrobotr...
XP_009226433      142 WIGRRSVHddgddgdggsrdeaAg-gLASWAEFRDGLKDRHAEAEATf-----------------------TPSIAAHRR 197 Gaeumannom...
jgi:THITE_2123868 148 WVCRRSEHad----------raEr-gTASWAEFERCFRDEHAAAEVAf-----------------------TPAAVAGHE 193 Thielavia ...
EMR72848          134 WCCRRSVHad----------epRs-gTASYAEFDRCFRLEHAESEAAf-----------------------TPNVRAVNE 179 Eutypa lat...
EFX02506          133 WFCRRSRHpn----------aaMa-gTASWTEFRTYLKDNHAASEDDm-----------------------TDNITGARE 178 Grosmannia...
ERT03173          127 WACRRSFHnn-----------lTqngTADWLEFLKHMKDEHVKTEDDm-----------------------TDTVVGTNT 172 Sporothrix...
Q7SH29            180 WACRRSVHrds--------nvpGd-gSASWGEFVTCFKDKHVECEEAf-----------------------TPSIVGARV 227 Neurospora...
XP_003351053      181 WACRRSVHrds--------nvpRd-gSASWGEFVTCFKDKHVECEEAf-----------------------TPSIVGTRM 228 Sordaria m...
XP_003713475      119 WVCRRSVHed----------lsIr-gTASWAEFRDCLKDRHAETEKAf-----------------------TPTMVAHQT 164 Pyriculari...
XP_008083389      128 WCCRKSVHrd----------vaEt-gTATWREFVHNFKDHHAESERDf-----------------------TPTVMEARK 173 Glarea loz...
EGX53386          217 LER---------------------------------RVVk---------------------GVGRVDVYHLSAQFP-GP- 240 Arthrobotr...
XP_009226433      198 AAAwdc----------------------------ggVEVevaaggaag-----eeattttwGDFTLAVEEARHRIG-RPl 243 Gaeumannom...
jgi:THITE_2123868 194 ALVwavdgrggeqrgrgdegaggagagtggnggvrpLEVeegg---------------rvwGRFTLKVVEMRHRVG-RPv 257 Thielavia ...
EMR72848          180 AVRwdc----------------------------egVRLaipepgpgdgdgdgdgstvtwwGDFRLVVEEMRHHVG-TG- 229 Eutypa lat...
EFX02506          179 ALVwpa----------------------------agLALqgaee------------ggrrwSNFPLGVYEIRHKLS-KP- 216 Grosmannia...
ERT03173          173 AYTwndihramsidln--------------------------------algmrpirgpsvwTDFTLQVVEMKHDLGsKL- 219 Sporothrix...
Q7SH29            228 LQDydv----------------------------agLTLedeh--------------gdryGNPTMKLVEARHKIGiKPl 265 Neurospora...
XP_003351053      229 LRDydv----------------------------sgLQVddeh--------------gdryGSFKMKVVEARHKIGvKPl 266 Sordaria m...
XP_003713475      165 VQEhlvvr------------------------dmepVSVdgl-----------------ryGDFTCATEGVRHKVA-PCi 202 Pyriculari...
XP_008083389      174 ALEwdt----------------------------egIEVevng---------------erwDNITMVLCESKHKIDpKP- 209 Glarea loz...
EGX53386          241 SAPRDFVTACTTSSSSapprtstatVtks------gkQGreFTMVSRPL-S----------------------------- 284 Arthrobotr...
XP_009226433      244 LRDRVFAVLQLTSAVVaapa--gggD------------E--FVVVSIPIvDeaegereagtvtgkgngkgkekeagaeae 307 Gaeumannom...
jgi:THITE_2123868 258 LKDRTFPVLQMTAAAVvdglaggasD------------E--FVVVSIPVpDfals------------------------- 298 Thielavia ...
EMR72848          230 LNDRTFPVLQVSCVAVppaggggggGgggvegapepePE--FFFISIPVpDfge-------------------------- 281 Eutypa lat...
EFX02506          217 LHTRVFPVLQMTCAAVsggsgsegeDqiqngndellvPE--FLVVSVTVnNfatapmp---------------------- 272 Grosmannia...
ERT03173          220 FDYRVFPVLQMSCLSVqsap------------------hdeFLVISVPInGwgaap------------------------ 257 Sporothrix...
Q7SH29            266 LKDRVFTVLQVTCSLLpreaggaaaDc----------DE--ILVISIPVsDvenftttaas------------------- 314 Neurospora...
XP_003351053      267 LKDRAFTVLQVTCSLLppgrgsaagVgskc----edsSE--ILVMNIPVsDveslatttts------------------- 321 Sordaria m...
XP_003713475      203 LQDRVFFVLQITCSVLde------eNatt------aaHE--FLVVNIPMaDhpds------------------------- 243 Pyriculari...
XP_008083389      210 LKNRTFPVVQVTAMLAg-------aK------------E--FLVISIPLtDfdks------------------------- 243 Glarea loz...
EGX53386          285 -----------HSSAPEQSGFVRGKYESIEFIREIIPdteeeeesaprrsmsvsdltqrasvllsvedasrpvgrkrsrt 353 Arthrobotr...
XP_009226433      308 aeaevarkllpVLELARDGGVVVGAYVSVERVRRLG-------------------------------------------- 343 Gaeumannom...
jgi:THITE_2123868 299 ----------ehsKLAREPGALVARYVSVERFRRL--------------------------------------------- 323 Thielavia ...
EMR72848          282 --------dkeRSKLASKPGALVAVYVSVERVRTL--------------------------------------------- 308 Eutypa lat...
EFX02506          273 ----gedatdvALRLSSQPGVVLGFYASVERVRLLPTg------------------------------------------ 306 Grosmannia...
ERT03173          258 -------vphdGRKLANGPRTTIGSYVSVERFRLGPKtqpeaplqkvstfgkvksslrikklkprpsvaqiaea------ 324 Sporothrix...
Q7SH29            315 ---pikgkssnkeEDPFRKDSIKGSYVSVERIRKLP-------------------------------------------- 347 Neurospora...
XP_003351053      322 ----svegktgnkEDPFRKDAVKGSFVSVERIRKLP-------------------------------------------- 353 Sordaria m...
XP_003713475      244 -----------ldpQALYRGATLGAYASVERIRILPAg------------------------------------------ 270 Pyriculari...
XP_008083389      244 ----------pysKFAKDKSLVIASYTSIERVRVL--------------------------------------------- 268 Glarea loz...
EGX53386          354 vgetprkavsfdesstpvngnamprtgtfgsdplkghrasrlreaisaddlpedeegkvpsadiaeqkvkntsvggvave 433 Arthrobotr...
XP_009226433          --------------------------------------------------------------------------------     Gaeumannom...
jgi:THITE_2123868     --------------------------------------------------------------------------------     Thielavia ...
EMR72848              --------------------------------------------------------------------------------     Eutypa lat...
EFX02506              --------------------------------------------------------------------------------     Grosmannia...
ERT03173          325 ------------------------------------------------apvqqaeqasreegsaagalqtadqagiarda 356 Sporothrix...
Q7SH29                --------------------------------------------------------------------------------     Neurospora...
XP_003351053          --------------------------------------------------------------------------------     Sordaria m...
XP_003713475          --------------------------------------------------------------------------------     Pyriculari...
XP_008083389          --------------------------------------------------------------------------------     Glarea loz...
EGX53386          434 egdmdSLegDGETNPVEWIMLTRSDPGGSVPRFMVERGTPGSIIKDAEKFLDWA 487 Arthrobotrys oligospora ATCC 24927
XP_009226433      344 -----AGeaEAEAGKIEWVMATASDARGVLPARVQAMAVPSQIVKDVPWFLAWA 392 Gaeumannomyces tritici R3-111a-1
jgi:THITE_2123868 324 ------Gg-DGEE-RIEWLMATASDAGGVLPMWVQNMATPGVIWKDVPLFLDWI 369 Thielavia terrestris NRRL 8126
EMR72848          309 ---------PGGGRGVEWLMATASDARGVLPAWVQNMAMPAVIWKDVPLFLGWI 353 Eutypa lata UCREL1
EFX02506          307 -----AGdnRGTG-LVEWVMATTSNARGALPSMVQELAIPGEISKDVPLFFRWL 354 Grosmannia clavigera kw1407
ERT03173          357 vnpedVPdnYLDNLQIEWVMATASHARGNIPLFVQKPFIPKKIAIDVPLFLK-V 409 Sporothrix schenckii ATCC 58251
Q7SH29            348 -----TTenDNQA-QIEWLMATASDARGSLPGWVQTMAVPGQIAKDVTLFLEWV 395 Neurospora crassa
XP_003351053      354 -----TTenDGQA-QIEWIMATASDARGSLPGWVQTMAVPGQIAKDVTLFLGWV 401 Sordaria macrospora k-hell
XP_003713475      271 -----HEdaG----KIEWIMATASDAKGILPRFAQDLAVPDQIVKDVPLFFDWI 315 Pyricularia oryzae 70-15
XP_008083389      269 ----------PDSGDIEWIMATASNAKGVLPQFVQNMAVPGAIAKDVEFFMSWI 312 Glarea lozoyensis ATCC 20868
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap