4RC6,5UWZ,4PG1


Conserved Protein Domain Family
Ald_deCOase

?
pfam11266: Ald_deCOase 
Click on image for an interactive view with Cn3D
Long-chain fatty aldehyde decarbonylase
This cyanobacterial family of fatty aldehyde decarbonylases acts on mainly C16 and C18 substrates to form hydrocarbons and carbon monoxide. Note that the corresponding EC number (EC:4.1.99.5) dating from 1989 refers to a nonorthologous Pisum sativum enzyme that acts on C18 and longer chains and attaches the overly narrow narrow name octadecanal decarbonylase.
Statistics
?
PSSM-Id: 402726
View PSSM: pfam11266
Aligned: 21 rows
Threshold Bit Score: 336.635
Threshold Setting Gi: 427345506
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4RC6_A         1 QSESYKDAYSRINAIVIEGEQEAFDNYNRLAEMLPDQRDELHKLAKMEQRHMKGFMACGKNLSVTPDMGFAQKFFERLHE 80  Synechococcus e...
Q2JJ13        22 GSAVYRQAYSRINGIVIEGEQEAHDNYLKLAEMLPEGAEELHKLAKMELRHMKGFQSCGKNLQVEPDREFARTFFAPLRN 101 Synechococcus s...
5UWZ_A        14 RSDTYRDAYSRINAIVLEGEREAHANYLTLAEMLPDHAEALKKLAAMENRHFKGFQSCARNLEVTPDDPFARAYFEQLDG 93  Gloeobacter vio...
4PG1_A        27 TSDRYKDAYSRINAIVIEGEQEAHDNYIAIGTLLPDHVEELKRLAKMEMRHKKGFTACGKNLGVEADMDFAREFFAPLRD 106 Prochlorococcus...
WP_011932566  26 SSEAYKDAYSRINAIVIEGEQEAHDNYISLGTLIPEQADELARLARMEMKHMKGFMSCGRNLGVEADMPFAKEFFGPLHG 105 Synechococcus s...
Q7VD51        21 SSSQYKDAYSRINAIVIEGEKEAHDNYMSIGTLIPDKADELKKLAVMELKHMRGFTACGKNLGVKADIPFAEKFFSPLHG 100 Prochlorococcus...
Q46GP5        25 TSESYKDAYSRINAVVIEGEQEAYSNFLDLAKLIPEHADELVRLGKMEKKHMNGFCACGRNLAVKPDMPFAKTFFSKLHN 104 Prochlorococcus...
WP_012628390  13 YSETYRNAYRRVNGIVIEGEKQAYDNFIRLAELLPEYQAELTRLAKMEARHQKSFVACGQNLKVSPDLDFAAQFFAELHQ 92  Cyanothece sp. ...
WP_012625892  13 YSETYQDAYSRIDAIVIEGEQEAHDNYLKLTELLPDCQEDLVRLAKMEARHKKGFEACGRNLKVTPDMEFAQQFFADLHN 92  Cyanothece sp. ...
WP_012164377  13 YSDTYKDAYSRIDGIVIEGEQEAHENYIRLGEMLPEHQDDFIRLSKMEARHKKGFEACGRNLKVTCDLDFARRFFSDLHK 92  Acaryochloris m...
4RC6_A        81 NFKAAAAEGKVVTCLLIQSLIIECFAIAAFNIYIPVADAFARKITEGVVRDEYLHRNFGEEWLKANFDASKAELEEANRQ 160 Synechococcus e...
Q2JJ13       102 NFQKAAAAGDLVTCLVIQSLIIECFAIAAYNIYIPVADEFARKITEGVVKDEYLHLNFGERWLGEHFGEVKGQIEAANAQ 181 Synechococcus s...
5UWZ_A        94 NFQQAAAEGDLTTCMVIQALIIECFAIAAYNVYIPVADAFARKVTEGVVKDEYTHLNFGQQWLKERFVTVREGIERANAQ 173 Gloeobacter vio...
4PG1_A       107 NFQTALGQGKTPTCLLIQALLIEAFAISAYHTYIPVSDPFARKITEGVVKDEYTHLNYGEAWLKANLESCREELLEANRE 186 Prochlorococcus...
WP_011932566 106 NFQTALKEGKVVTCLLIQALLIEAFAISAYHIYIPVADPFARKITEGVVKDEYTHLNYGQEWLKANFEASREELMEANKV 185 Synechococcus s...
Q7VD51       101 NFQKAFKEENLTTCFLIQAILIEAFAISAYHVYIRVADPFAKKITENVVKDEYLHLNYGQQWLKANLDTCKEELMKANKE 180 Prochlorococcus...
Q46GP5       105 NFLEAFKVGDTTTCLLIQCILIESFAISAYHVYIRVADPFAKRITEGVVQDEYLHLNYGQEWLKANLETVKKDLMRANKE 184 Prochlorococcus...
WP_012628390  93 IFASAANAGQVATCLVVQALIIECFAIAAYNTYLPVADEFARKVTASVVQDEYSHLNFGEVWLQNAFEQCKDEIITANRL 172 Cyanothece sp. ...
WP_012625892  93 NFQKAAAANKIATCLVIQALIIECFAIAAYNIYIPVADDFARKITENVVKDEYTHLNFGEEWLKANFDSQREEVEAANRE 172 Cyanothece sp. ...
WP_012164377  93 NFQDAAAEDKVPTCLVIQSLIIECFAIAAYNIYIPVADDFARKITESVVKDEYQHLNYGEEWLKAHFDDVKAEIQEANRK 172 Acaryochloris m...
4RC6_A       161 NLPLVWLMLNEVADDARELGMERESLVEDFMIAYGEALENIGFTTREIMRMSAYG 215 Synechococcus elongatus PCC 7942 = FACHB...
Q2JJ13       182 NLPLVWQMLQQVDQDVEAIYMDREAIVEDFMIAYGEALANIGFSTREVMRLSAQG 236 Synechococcus sp. JA-2-3B'a(2-13)
5UWZ_A       174 NLPIVWRMLNAVEADTEVLQMDKEAIVEDFMIAYGEALGDIGFSMRDVMKMSARG 228 Gloeobacter violaceus PCC 7421
4PG1_A       187 NLPLIRRMLDQVAGDAAVLQMDKEDLIEDFLIAYQESLTEIGFNTREITRMAAAA 241 Prochlorococcus marinus str. MIT 9313
WP_011932566 186 NLPLIRSMLEQVAKDAAVLKMEKEDLIEDFLIAYQEALEEIGFTSRDIARMAAAA 240 Synechococcus sp. WH 7803
Q7VD51       181 NLPLIKSMLDQVADDACSLSMDKEELMEEFMIAYQDSLLEIGLDSREIARMALAA 235 Prochlorococcus marinus
Q46GP5       185 NLPLIKSMLDEVSNDAEVLHMDKEELMEEFMIAYQDSLLEIGLDNREIARMALAA 239 Prochlorococcus marinus str. NATL2A
WP_012628390 173 ALPLIWKMLNQVTGELRILGMDKASLVEDFSTRYGEALGQIGFKLSEILSLSVQG 227 Cyanothece sp. PCC 7425
WP_012625892 173 NLPIVWRMLNQVETDAHVLGMEKEALVESFMIQYGEALENIGFSTREIMRMSVYG 227 Cyanothece sp. PCC 7425
WP_012164377 173 NLPIVWRMLNEVDKDAAVLGMEKEALVEDFMIQYGEALSNIGFSTGEIMRMSAYG 227 Acaryochloris marina
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap