Conserved Protein Domain Family
Med25_VWA

?
pfam11265: Med25_VWA 
Mediator complex subunit 25 von Willebrand factor type A
The overall function of the full-length Med25 is efficiently to coordinate the transcriptional activation of RAR/RXR (retinoic acid receptor/retinoic X receptor) in higher eukaryotic cells. Human Med25 consists of several domains with different binding properties, the N-terminal, VWA domain which is this one, an SD2 domain from residues 229-381, a PTOV(B) or ACID domain from 395-545, an SD2 domain from residues 564-645 and a C-terminal NR box-containing domain (646-650) from 646-747. This VWA or von Willebrand factor type A domain when bound to RAR and the histone acetyltransferase CBP is responsible for recruiting Med1 to the rest of the Mediator complex.
Statistics
?
PSSM-Id: 402725
View PSSM: pfam11265
Aligned: 15 rows
Threshold Bit Score: 253.373
Threshold Setting Gi: 300163586
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_019850611    7 SSKRRQIIFVVDASTALSGIFKHLLTDYIVPCIEFFNGGPV-AESNAG-AQCV-NYYGVITIKPLALFSVPSCNYFPLTS 83   Amphimedon qu...
XP_008183074    8 HSVQTDIIFVIEKTA-MNTYISELKTNYVTPTLEYFNQGPI-EERDYL-SESSsAIYGIVVYEANDCKPYPCCRTYGTFT 84   pea aphid
EEB13846        8 HTVQADIVFVIEGTAINGAYLNDLKTNYLLPTLEYFSQGNL-EDRDYV-CEGTsTLYGLVVYHAADILPKSSCDCYGPYS 85   human body louse
1_pfamImport    1 ICALADVIFIIEGTAINGAYLNDIKTNYIIPTLEYFNQGNL-EERDYV-CESTsALYGIVVYHAADRLPSPSTDIYGPYS 78  
EFA02633        8 HGLQADIVFVIEGTAVNGAYINDLKTNYIIPSLEYFSQGSI-DESSFL-SEGInSYYGIVVYQAADCLPHPSSDTIGPFV 85   red flour beetle
EEC17383        7 GNWVADVVIVVEGTANLSPYVDSLKSHYIVPTLEYFNGGPI-DDRDCG-YDTNsTTYALVVFMAADCATEPAATCNAPTT 84   black-legged ...
XP_009008966    6 NQKVYDVAIVVEATSGAADYYETMRTSYLLPILEFFNGHSI-DEPVYG-YCCNsSLYSLITYKGNDHPFSNMSTCSSPTY 83   Helobdella ro...
XP_001627984    6 SHGEHEVVFVVEGTANLLLHFETLKTEYIDPIIEYINGGPVqESNSFFgDENGpNQYCLVVYGTKASHPEDAVQLVRYTR 85   starlet sea a...
Q6PEH8          9 LNQVSDVVFVIEGTANLGPYFESLRNNYILPTIEYFNGGPP-AETDFG-GDYGgTQYGLVVFNTVDCAPESYVQCHAPTS 86   zebrafish
ACB88864       12 GSVVADVVFVIEGTANLGPYFEGLRKHYLLPAIEYFNGGPP-AETDFG-GDYGgTQYSLVVFNTVDCAPESYVQCHAPTS 89   human
XP_019850611   84 SPSDLLQNLHNICFEGNMIEHCCRASEGLAAALEFMELTKSIViGnSDSnEIEKYCIFISNLPPSSMPVMESVTYGNMSY 163  Amphimedon qu...
XP_008183074   85 SPQKVIKMIEKIDMIGGMAESHAYMGEGLATALVFFEDLQEIR-E-----AKQRHCILICNSPPYNFPIMECETYAGRGV 158  pea aphid
EEB13846       86 SPQKLLMTLDKLELIGGKGESHANIAEGLATALQAFEDLQQKR-EgNNI-ITQKHCILVCNSPPYFMPVMEASTYSGHTI 163  human body louse
1_pfamImport   79 NPHKVLQMLDKIELVGGRGESHANVAEGLASSLICLDDLQQRR-E-PGL-APQRHCILISNSPPYMMPVVENQAFTGNTA 155 
EFA02633       86 SPSKVLNAIDKLELIGGKGESHANIAEGLATTLQCFDELQQKR-DnNG--NIQKHCILVCNSPPYSLGVFETHAYTGKTA 162  red flour beetle
EEC17383       85 NVAKLLSWFDRVSFVGGGGESCSHIAEGLGTALQVFDDFQALR-E-PSV-VVQKHCVLVCNSPPYRLPSLESPVYAGHTV 161  black-legged ...
XP_009008966   84 NCHEFAQTLNQISFSGGMLDPHSFIAEGLATALSLFEDIDLIR-KnRV--KAEKHLILYCSNGPYQFPCLGHYKYLNKTT 160  Helobdella ro...
XP_001627984   86 DVHDFLQALNEVKFDGGGGQDCSLLAEGMGFALQAFDEMRVSR-GsV---NCHRHCIVVCNSPPFPQPSRECLSYLNKTV 161  starlet sea a...
Q6PEH8         87 SAFEFVSWIDSIQFMGGGAESCSLIAEGLSVALQLFDDFKKMR-EqIG--QTHKVCVLLCNSPPYLLPAVESVSYTGCTA 163  zebrafish
ACB88864       90 SAYEFVTWLDGIKFMGGGGESCSLIAEGLSTALQLFDDFKKMR-EqIG--QTHRVCLLICNSPPYLLPAVESTTYSGCTT 166  human
XP_019850611  164 MQLAEEMA--KN-NVSLSVITPRWLIPYADLFVKGAlsPPYdnSILTHADHALHPGCMVLLRGL 224  Amphimedon queenslandica
XP_008183074  159 DQIANLFQ--EK-GILLSILSARKTPALLKLFEKAG--GDL--QISQNKNYAKDPRHLVLLNGY 215  pea aphid
EEB13846      164 DQLAAILN--EQ-NINLSILSPRKIPAIFKLFEKAG--GDL--TQSQNKNYAKDPRHLVLLKGF 220  human body louse
1_pfamImport  156 EQLASLLN--ENiNVHLSILSPRKIPAMFKLFEKAG--GDL--SASQNKNYAKDPRHLVLLKGF 213 
EFA02633      163 EQLAAILQ--EK-NINLSIISPRKIPSLYKLFEKAG--GDL--SASQTKNYAKDPRHLVLLRGF 219  red flour beetle
EEC17383      162 DQLAGIMA--ER-QVNFSILSPRKIPALYKLYEKAG--GDL--QLALAKNYAKDRRHMVLLRGY 218  black-legged tick
XP_009008966  161 EQLVNLLA--ES-NIHFSIISTRKIHSLVKLFELGQ--PD---PSCLTKNYASDSTHLVLLNDI 216  Helobdella robusta
XP_001627984  162 DQLAAIMAkpEN-NIHLSIISPRKFPALQLVFDKSL--RDDtkGMKSKTDYAKEPQHMACLQGI 222  starlet sea anemone
Q6PEH8        164 DSLVQIIR--DR-GIHFSVIAPRKLPALRSLFERASsvAGL--PESSHPDYSQDPFHMVLVRGI 222  zebrafish
ACB88864      167 ENLVQQIG--ER-GIHFSIVSPRKLPALRLLFEKAAp-PALlePLQPPTDVSQDPRHMVLVRGL 226  human
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap