5MLF


Conserved Protein Domain Family
ThylakoidFormat

?
pfam11264: ThylakoidFormat 
Click on image for an interactive view with Cn3D
Thylakoid formation protein
THF1 is localized to the outer plastid membrane and the stroma. THF1 has a role in sugar signalling. THF1 is also thought to have a role in chloroplast and leaf development. THF1 has been shown to play a crucial role in vesicle-mediated thylakoid membrane biogenesis.
Statistics
?
PSSM-Id: 402724
View PSSM: pfam11264
Aligned: 51 rows
Threshold Bit Score: 204.738
Threshold Setting Gi: 223995057
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5MLF_F        23 TVSDTKRAFYAAHTRPIHSIYRRFIEELLVEIHLLRVNVDFRYSPLFALGVVTAFDQFMEGYQPEGDRDRIFHALCVAEE 102 Thermosynechoco...
XP_002287212   2 TVGEAFTQFTDKLGTPVNALYKGMCTDLVGSLHLVMVNARFQRDAVFSLGLVSALDLVLKNYPEAETGARIKSAMLESVG 81  Thalassiosira p...
EEC46621      67 TVGEAFADFSSELGVTVNPLYKNMVTDIVGTTHLVIVNARFQRDAIWSLGILTALDLLLKNYPEPEVGAKIVSALFKSVG 146 Phaeodactylum t...
Q84453        10 TVSDTKRIFYANYKKLLLPLYNTPIQNMLVKQHIHRYNKNYTYSDVSALGIVTTLDSVLNTF-PDDEKTSIKNAFIISLN 88  Paramecium burs...
XP_002326111  70 TVADTKLNFLKAYKRPIPSIYNTVLQELIVQQHLMKYKKTFRYDPVFGLGFVTVYDQLMEGYPSDEDREAIFQAYIKALE 149 black cottonwood
Q7XAB8        67 TVADTKLKFLTAYKRPIPTVYNTVLQELIVQQHLTRYKKSYQYDPVFALGFVTVYDQLMEGYPSEEDRNAIFKAYIEALK 146 potato
XP_006841855  71 TVAETKGNFLRSYKRPIPSIYNTVLQELIVQQHLLRYKRTYQYDAILALGFVTVYDQLMEGFPSNEDRDAIFKAYVEALK 150 Amborella trich...
EFN57011      52 TVADAKLKFNGAFKKPLPAIYSTVVQELLVQQHLFRWNKQYQYNEVTALGIVSIFEQVLGGL-PDAEREAVFDAFINALQ 130 Chlorella varia...
EDP08911      44 TVAETKAKFLSGYNKPIASIYSTVLQELLVQQHFMRYSKNYQYNPIFALGFVSVYEQILESL-SAEERGAIFKAYVDALG 122 Chlamydomonas r...
XP_002501243  51 TLADTKRKFVESYPYPIPSIWSVAVNELLANQHFVRYSTRYSYSKLSSLGFVSVYDQLFEGFPSDEEKAKIFDCFVEALG 130 Micromonas commoda
5MLF_F       103 MNPQQLKEDAASWQQYQGR-PLSQILDELNSGQPSAPLNSl-----------NHTGKYSRLHAVGLYAFLQELAGEVt-i 169 Thermosynechoco...
XP_002287212  82 LDEAVVNAEAAALEAWAQGkTKEDIASALKGE------GDsqlaaiakaakgDQWWMYSRFFGVGLVRIMEIVGVEMdms 155 Thalassiosira p...
EEC46621     147 LDEDEIRNEARTISDWAVGkSKADIETALTGE------GDspvaaiansikpNDYWMYSRYFGIGLIKIMESTGVEMdkd 220 Phaeodactylum t...
Q84453        89 EDPEMYYSNIESLKPYAKS------------SHLGPNKHGntlqkslydiaiNDKYVYSSFAAVGIFKLLQMng-----n 151 Paramecium burs...
XP_002326111 150 EDPEQYRIDAKKLEEWARAqTPSSLVDFSSREGEIEGTlkdia-----ervasGNFSYSRFFAVGLFRLLELSNA----- 219 black cottonwood
Q7XAB8       147 EDPEQYRADAQKLEEWARTqNANTLVDFSSKEGEIENIfkdia----qragtKDGFCYSRLFAVGLFRLLELANV----- 217 potato
XP_006841855 151 EDPEQYRNDAKKLEEWARAqNANSIVDFSSREGEVEAIlkdis----graggKGNFSYSRFFAIGLFRLLELANV----- 221 Amborella trich...
EFN57011     131 EDPKQYRKDAAAMEELARGkS----------EVAPDASGDkvqqalaavaakEGKFLYTKFFAVGLFRLVELTGS----- 195 Chlorella varia...
EDP08911     123 EDADKYKRDASALEQAANGlTPESLTPNADGNEVQKALasis------sasaAGAFSYNKFVAIGLFRLLELSGA----- 191 Chlamydomonas r...
XP_002501243 131 EDPEKCRKDAAELAKFAKE------------AGGVDALLAspvlaeiksngeANKFAYSRYDAIGLFRMLELGGA----- 193 Micromonas commoda
5MLF_F       170 HLNETLDQ-LAPVIPLPIEKVKRDLELYRSNLDKINQARSLMKELVEQERKRRAQQT 225 Thermosynechococcus elongatus BP-1
XP_002287212 156 VAYDVMENwMGKCMEKPYYTACSDSDLYFKTKGKLDMMETMMKEIEIREKKRMAdrl 212 Thalassiosira pseudonana CCMP1335
EEC46621     221 EVYPVMESwMQEKLGRSSLTACADSDLYFKIKDKLDMMETMMKEIEIREKKRMAERl 277 Phaeodactylum tricornutum CCAP 1055/1
Q84453       152 YTGNSVKH-LSESIGFKGELVHKDIATFFSLLKYIESSQKLADDIREESLKRKSKSs 207 Paramecium bursaria Chlorella virus 1
XP_002326111 220 SEPTVLEK-LCSALNINKRSVDRDLDVYRGLLSKLVQARELLKEYVDREKKKQEERA 275 black cottonwood
Q7XAB8       218 TDPTILEK-LCAALNVNKKSVDRDLDVYRNLLSKLVQAKELLKEYVEREKKKRGERE 273 potato
XP_006841855 222 TDSAILEK-LCAALNVDKRSVDRDLDVYRNLLSKLVQAKELLKEYIDREKKKREERS 277 Amborella trichopoda
EFN57011     196 KDPKSLTT-LVKALGLSQERVNADLMTYKGVLSKLEAAKEIMKEFMAREKVKRAERE 251 Chlorella variabilis
EDP08911     192 KEPSALEK-LVKAVGVKPEAVNRDLLMYKGVLSKLAAAKELMREFVEREKRKQAERD 247 Chlamydomonas reinhardtii
XP_002501243 194 TEPAALEK-LADAAGLKLKKVNGDLGMYKGLLSKLAAAKELQKEIFEREKRKTAERl 249 Micromonas commoda
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap