Conserved Protein Domain Family
Focadhesin

?
pfam11229: Focadhesin 
Focadhesin
Focadhesin (FOCAD) is focal adhesion protein with potential tumor suppressor function in gliomas.
Statistics
?
PSSM-Id: 402696
View PSSM: pfam11229
Aligned: 14 rows
Threshold Bit Score: 998.838
Threshold Setting Gi: 0
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_007668745  479 MNKIRMLTEKNQQTPGFALALGNLVHGLSVCGHGKAEDLSNKLLPPWIKIVLTEGSSTMQCLAALNGLVSLVGSEGVLFQ 558  platypus
XP_014351073 1167 INKLRALTEQNQQTPGFALALGVIVNGLAVCGHGKAEDLSNRLLPAWIKILLAEGCSTMQRLAAVNGLVTLLGSETSLIQ 1246 coelacanth
XP_022534022 1211 MNVLRSVTEESQQTPGFALALGLTVHGLSSCGHGKAEDIHPRLLAAWTKILLAEGCPTMQRLAALNGLIALVGSETGLLQ 1290 Mexican tetra
XP_009301365 1221 MNTLRALTEESQQTPGFALALGQTVFGLSSFGHGKAVDIQPRLLAAWTKILLAEGCPTMQRLSALNGLIALVGSETALIQ 1300 zebrafish
3_pfamImport    1 MKALRCLTEDNRQAAGFSMALGMLVHGLAACGHGKAEEAQPHLLASWMKTLLTEGCPTMHRLAALSGLLALVGSEANVFQ 80  
XP_027302524 1188 MNKLRTLVEDNQQTSAFALALGTIVHGLSVCGHGKAEDLRNKLMPAWIKTLIAEGSPTMQRLAAVNGLVALVGSEGGMIQ 1267 mallard
XP_003216652 1216 MNKLQKLTESNQQTAGFALALGNIVHGLSVCGHGKAEDLGNRLFPAWMRILLAEGAPTMQRLAAINGLVSVVGSEGTMIQ 1295 green anole
XP_011604804 1212 MNTLRNLTEESQQTTGFSLALGMVVHGLSMCGHGKAEDIHPHLLASWMKILLAEGCPTMHRLAAVSGLVALVGSESCIIH 1291 torafugu
XP_027143816 1219 MNTLRSLTEESQQTPGFSLALGLVVHGLSMSGHGKAEDIHPRLLAAWIKILLAEGCPTMQRLAAVNGLVALVGSESYLVQ 1298 large yellow ...
XP_015200548 1031 MNNLRLMTEKSQQTPGFALSLGITVHGLSACGHGKAEDFYFRLLGAWIKILLTEGCPTMQRLAAVNGLVALVGSESSLIQ 1110 spotted gar
XP_007668745  559 MKSDPIQSSQFQGKLKEVIRTIIQLTNLSAVIGVQSNAVWLLGHLHLSSLSANQSRASVPADFSYLSENSFIRAAIDFLI 638  platypus
XP_014351073 1247 LKSETIQSSQFQSKLNEVIRTITQIISFSGVIGLQSNAAWLLGHLHLANLSASQSRTSVPPDFSYLSEKSVIRAATDYIV 1326 coelacanth
XP_022534022 1291 LKSETEQSSQQQARLNEVIRSITQIISFSGAIGLQSNGACLVGHLHLAHMSSSHSRTAVPQDFSYLPERSLIRASVEYIT 1370 Mexican tetra
XP_009301365 1301 MKSECEETSLQHSRLNEVIRAITQIITFSGTIGLQSNGACLLGHLHLTHASSRHSRTAVPQDFGYLSESSVIRASVDFIT 1380 zebrafish
3_pfamImport   81 LEAELEASSQQQSRLNEVIRAVTQVITLSGAIGLQSNCACLLGHLHLSQVSNSPRPGAAPQDFSYLPERSVLRWVVSFLT 160 
XP_027302524 1268 LKSESIQSSQFQSMLNEVIRTLTQIISFSGQIGLQTNAAGLLGHLHMSCLSSTQSRASVPPDFSYLPENSFIRAAIDFAI 1347 mallard
XP_003216652 1296 LKTEAIQSSQFQSKLNEIIRTLSQIISFSGVIGLQTNAAWLLGHLYLSTVSATCSRTSVPPDFSYLPEKSFLRAAIDFVI 1375 green anole
XP_011604804 1292 LKSELEISSQQQSRLNEVIRAVTQVVTLSGAIGLQSNSACLLGHLYLAHMSNSCSHSSVPQDFSYLPEKSVIRSVATFLT 1371 torafugu
XP_027143816 1299 LTSELELSSQQQSRLNEVIRAITQVITFSGAIGLQSNSACLVGHLHLAHMSTSHSHTAVPQDFSYLSEKSVIRSIVDFLT 1378 large yellow ...
XP_015200548 1111 LKSESGQSPQQQSRLNEVIRAITQVITFSGAVGLQSNASCLVGHLHLANLSLGQTRTSVPPDFGYLSERSVIRAAVDYLI 1190 spotted gar
XP_007668745  639 DGGKKG---PESVPASCVKTVMKPIVTVGKSYQYPPVNWASLLSPLLRLNFGEEVQLLCIQLMVTQAQSSQNAAMLLGMW 715  platypus
XP_014351073 1327 EAGKKG---PETIPSQMIKVILGSIATAGSSYQYPPVNWAAILSPLMRLNFGEEIQRHSIEIAVTQAQSSQSATMFLGMW 1403 coelacanth
XP_022534022 1371 EAGRKG---PEFFPPDGIKVVLAPLATVGDNFQYPPVNWNAILSPMMRLNFGEEVQHHCLELAANQAQSSPSAALFLGVW 1447 Mexican tetra
XP_009301365 1381 EAGRKG---PEFTAPQRVKTLLSALAAVGADFQYPPVNWSSVLSPLMRLGFGEEVQHYCLELAASQTQSSQSASLFLGVW 1457 zebrafish
3_pfamImport  161 EAGRKG---PDEVRPPPVLTALSSLASVGARFQLPPINWGLPLAPLMRLGFGEDVQHECLALAASQAPWSQSAAVFLDSW 237 
XP_027302524 1348 ESGKKG---PESVPAQLLKVALAPIAIVGESHQYPPVNWASVLSPLMRLNFGDEVKHLCLELAVTQAQSSQNAAMLLGMW 1424 mallard
XP_003216652 1376 EAGKKG---PEKVQPSLVKAAMVPIALIGEKYQYPPVNWAALLSPLLRLDFGDEVQQLCIKLAVTQAQSSQNAAMLLGMW 1452 green anole
XP_011604804 1372 EA---GkkgPDFVHPVLVKTAVTSLASVGAGFQFPPVNWSVSLSPLMRLGFGEDVQHQCLVLAASQAHSSQSAALFLGSW 1448 torafugu
XP_027143816 1379 EAGKKG---PEFAHPALVKTALTPLASVGSSFQYPPINWSAVLSPLMRLSFGEDVQHQCVVLAACQAQSSQSASLFLGSW 1455 large yellow ...
XP_015200548 1191 EAGRKG---PEHLHPKLVNVVLGPLASVGSSFQYPPVNWGAILSPLMRLNFGNTVLFI-----------MSSIRFFYY-- 1254 spotted gar
XP_007668745  716 VIPPLVYSLSVKSRKYLFGSLSLWMKYVSVEQLQVFTKVFIVQHFEAKNRDQNPELCQESLEGLSQAMKIPNPAQHLWNP 795  platypus
XP_014351073 1404 LTPPLVHSLSMSTKKYLCSSVSLWMKQVPEDKLQLFAKKFGAQYFTAGNRHQNPDFCQVILEGLSQAMELPNPAQFCWSI 1483 coelacanth
XP_022534022 1448 LAPPLVHSLSLRTRALLYECLCSWMKHVAEDKLQVYVESLAVQQFNPDTRAQRHPLCLAILQGLAKAMSLPNPAQNCWSS 1527 Mexican tetra
XP_009301365 1458 LVPPLVHSLSLRTRAHLYESLSCWMKHVAEDKLQVYVDSLAVQQFEPLTRLQRLSLCLSILHGLSRAMTAPNPPQNCWSV 1537 zebrafish
3_pfamImport  238 LSPPAGPQSQGATRAHLYESLGSWMRHVGEDKLQAFVEQLGVQLFREE---RAAPVCQALLRGLAQAMALPNPPKHCWAL 314 
XP_027302524 1425 VAPPLVYSLSVKTQKYLLVSLPLWMKHVAEDKLQSFTEVFLTQQFEMKSHTKETEICQCVLQGLMQAMKIPNPAQYCWSF 1504 mallard
XP_003216652 1453 VAPPLVYSLSIQAKRYVFTSLPVWVKYVADDKLQAFTEIFMVQHFDTKKQAKNRELCWDILQGLHQAMKLPNPAQGNWSC 1532 green anole
XP_011604804 1449 VSPPLVHSLSHPTRVHLYESLGLWMKHVAEDKLQVYVDKLGLQHFQDKQNPHSLSMCQSLLRGLAQAMALPNPPKHCWTV 1528 torafugu
XP_027143816 1456 LSPPLVHSLSYQTRAHLYESLGLWMKHVAEDKLQVHVESLGLQQFQEDLRPQRLSMCRSVLQGLAQAMALPNPPNNCWTI 1535 large yellow ...
XP_015200548 1255 LIP------HLKTRAYLYKSVSVWMKHVPDDKLQSFVEVLGVQHLTASSRQQSPDLCVAVLEGLEQAMKLPNPTQFCWGV 1328 spotted gar
XP_007668745  796 LCQAAEKIFDILPNKIQRNEVDLYVMIAKCLAEMTDAEINRIFRITESNIEKTVFVRVYLISQGRFSLMSLNNVIDAVLE 875  platypus
XP_014351073 1484 LCKTVEKIFELLPNKIQRSEVELYIKLSKCLSEMADTEIDRITQVSKDNIEKATFIRAYLVSQGRVPLLSLNDILGTAVR 1563 coelacanth
XP_022534022 1528 LCTTTEKIYNLLPDHIQPSEVELYEGICSCLSEMSDTEIDRIVKVTEANVEKTTFILSYLSSKGRIPLLGLNDIISTVLQ 1607 Mexican tetra
XP_009301365 1538 LCSTAEKIYNLLPDSIPAAEVALYEAMCSCLSEMSDAEIDRIVKVSEANVEKTAFILSYLVSKGRVPLLGLNDVISTILQ 1617 zebrafish
3_pfamImport  315 LCSTTEKIYSILPDPKQEDEVGLYVGLARCLSEMSDTEIERITRVTEAGMEKSCLVLAHLTSEGRLPLLALNDVVAGALR 394 
XP_027302524 1505 LCQAAEKIYELLPNYFQRGELEMYVSVAKCISEMGDSEIDRIVQISKNNIEKAIFTKLYLISQGRLPLMNLSAMIYALTG 1584 mallard
XP_003216652 1533 LCKATERIFELLPNEIRQNEVKMYINSAKCLSEMTDTEVDQITQVSKNNLEKITFVKLYLVSQGRFPLLRWNDVISTAAG 1612 green anole
XP_011604804 1529 LSSTTEKIYSILPNQIQDNEVGLYVGLAKCLSELCDTEIDRITRVTEDRMEKAAFILAYLTSKGRLPFLGLNDVISGIRC 1608 torafugu
XP_027143816 1536 LCSTTEKIFTLLPNQIQDDEVDLYVGVTKCLSEMSDTEIDRIARVTENQMEKTCFILAYLTSQGRVPLLGLNDIIAGVLR 1615 large yellow ...
XP_015200548 1329 LRSTTERIFMLLPDEVQDDEVELYVRIATCLSEMEDTEIDRITRVTKANLVKTGFTMAYLVSQGRVPLLGLNDVIAAAIG 1408 spotted gar
XP_007668745  876 CDQRETVAWMILHSFY-HARIVSHPNTGVLKRLEWMLELMGIIRSVAYQSKPVQ--NVTLEKAVDFLFQIFAALVVAWGD 952  platypus
XP_014351073 1564 CNQTEAVSWMLLQCFY-QARLIAHQNTGVMTRIEWLLELMGHIRNVASGTTPLE--NTDLKRAVDFLLQIFAVSVVAWAD 1640 coelacanth
XP_022534022 1608 KGKTERISWLFLQCLY-QSRLASSPNTGVSKRMEWLLELMGHIRKVTYGA-SVK--CNRVREGTDFLLEVFAAAVVSWAN 1683 Mexican tetra
XP_009301365 1618 VGSKRPISWLLLQGLH-QSRFASGPNTGVSKRMEWLLELMGHIRNVAYGSPSVK--CVDVLQGTDFLLGVFAAAVVSWAD 1694 zebrafish
3_pfamImport  395 GWPSRRVGWILLQALHrHHHRAAKPGTGVSQQMGWLLELMGHLRSVTCGGSSHL--RGDASAATDFLFQVVAGAVVAWGD 472 
XP_027302524 1585 CYQKESIAWMFLHSFY-HARIVSHENTGVLKRMDWLLDLMGYIRNLAFKSTPIQ--NVDLKEFIDFLLWLFAASVVAWAD 1661 mallard
XP_003216652 1613 CQEKETIVWMLLHSFY-HARIVSHENTGVLKRMEWLLELMGYIRNVSLKTTSVP--NVAPKEALSFLVWIFAAAVVAWAD 1689 green anole
XP_011604804 1609 GWPGHRVGWILLQAFY-QCHRGTNPSTGVSQQMEWLLELMGHIRNIAYGG--KAepSGDTSAATDFLFHVFAAAVVSWGD 1685 torafugu
XP_027143816 1616 GWSSRRVGWLLLQTFY-QCRLATGSNTGVLKRMEWLLELMGHIRNVAYGATPVI--CGDTKLATDFLFQVFAAAVVSWGD 1692 large yellow ...
XP_015200548 1409 SCHQEAVSSLLVRSFY-QSRLAASPNTGVLKRMEWLLELMGHIRNVAYGSTPVE--NGDVKQATDFLLQLFCAAVVSWAD 1485 spotted gar
XP_007668745  953 HATPLLLGFSASWLSWHKEHGessFAACSPNYLGHSPLNRLTLKETLTLLPNSMHLLLTKEPWKEHTPKFIDWLFNILES 1032 platypus
XP_014351073 1641 HTTPLLLGVSANWFPWKQEEAk--TANCPVNFLGCCSLNVLSVQGCLTVLPCSIQLLLAKEPWKEHTQKFIDWLFSIWES 1718 coelacanth
XP_022534022 1684 HSTPVIVGVRAQWFPWRQFSAe--YPDVPRGLYVNSVSTDESVKQCVLAVPYALKLLLDKEPWKSQSQKFIDWLFSITEA 1761 Mexican tetra
XP_009301365 1695 HGGPLLVGIRARWFPWPQSAE------LCHGLYANPEDTELPVASCLLAIPYSIRKLLDKEPWKSQSQKFIDWLFSITEA 1768 zebrafish
3_pfamImport  473 HVVPLLLGLGARWLPWQPQAR---PCFPEH---GQEARAEEALAQCLPGMPLSLARLLSTEPWSSQTDKFIDWLLTITEG 546 
XP_027302524 1662 HGAPLLLGLSASWSSWNHQTV---LPELSKDHIGKHSTDKIAVQETLTLLPSSIFLLLAKEPWKEQTQKFIDWLISMVES 1738 mallard
XP_003216652 1690 HAAPLLLGLNADWSLWEGKA----VPGVSPSLLGRQPIDNLAVQETLTLLPGSLQTLLSKEPWKEQTHKFFDWLFSIMEA 1765 green anole
XP_011604804 1686 HVVPLLLGVRATWLPWQPESK---PQILEHSLYGEESHVGNALPHCLLGMPLSLAQLLSKEPWSSQRHKFIDWLLSITEG 1762 torafugu
XP_027143816 1693 HFMPLLLGIRSQWFPWQPDSK---PQTLRHSLYGQESVTDNVLPQCLLGMSHSLSLLLDKEPWSNQTHKFIDWLLSITEG 1769 large yellow ...
XP_015200548 1486 HSLPLLLGIGAKWLPWKEDNA---VPSSPQARFGNSSADEQLALQCSKGLPYSIQLLLAKEPWKGQTHKFIDWFFSILEC 1562 spotted gar
XP_007668745 1033 PKEALSASTRDILKATLLALRFLPECKRKVVWTKVCGW 1070 platypus
XP_014351073 1719 PKKVLSETSKNVLKATLLNLRFLPEFKKKAVWTRAYGW 1756 coelacanth
XP_022534022 1762 PEEVLSPTAISTARAALLALKSNPEFKKKTVWTRAYGW 1799 Mexican tetra
XP_009301365 1769 PKQAFSETAVLTAKAALMALRSSSEFKKKTVWTRAYGW 1806 zebrafish
3_pfamImport  547 PEQSFSVGVVATAKASLLALQSFPGFQKKAVWTRAHGW 584 
XP_027302524 1739 PKEALSKSSTDLLKATLLALRSLAEFKKKAVWTKAYQW 1776 mallard
XP_003216652 1766 SNEVLSKSSRDLLKASLLALRSFPEFKKKAIWTKAYGr 1803 green anole
XP_011604804 1763 PEKSFSVAVTNAAKAALLALNSVPEFKKKLVWTRAYGW 1800 torafugu
XP_027143816 1770 PEQCLSAVTVSTAKAALLALRSSAEFKKKAVWTRAYGW 1807 large yellow croaker
XP_015200548 1563 PKQGLSERSIRTVKGALLALRYLPEFKKKVVWTRAYGW 1600 spotted gar
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap