Conserved Protein Domain Family
Med21

?
pfam11221: Med21 
Subunit 21 of Mediator complex
Med21 has been known as Srb7 in yeasts, hSrb7 in humans and Trap 19 in Drosophila. The heterodimer of the two subunits Med7 and Med21 appears to act as a hinge between the middle and the tail regions of Mediator.
Statistics
?
PSSM-Id: 402689
View PSSM: pfam11221
Aligned: 82 rows
Threshold Bit Score: 85.3878
Threshold Setting Gi: 300152253
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_002145257   1 MADILTQLQTCLDQ---LATQFYATLCYLSTYHDHVPATVPPPgsgitdsmpslakiprnqpsaapmpagavakqtaeqq 77  Talaromyces mar...
XP_009114546   1 M-DIISQLQEQVNS---IAAITFNAFGTLQRDAPPVQLSPNYPeppaaaa------------------------------ 46  field mustard
EFJ52925       2 sSDLLTELQRQLRD---VNDQFAIVIEQLIHIAPPAPLEGDSGqivaeep------------------------------ 48  Volvox carteri ...
ESS28669       8 aADPVTRLQQLLTN---FSRHLYDVVQQVPELAPPLPLSPTDSssssass------------------------------ 54  Toxoplasma gond...
XP_004348835  71 T-DRLTQLQDRISQ---MAEMLFTSVGVLKDFRPTDAASQTATilpagap------------------------------ 116 Capsaspora owcz...
CDS38069       1 MADRLTELQDAINL---QAENLGNAVGVIQQLAQPSLFRelnhngrr--------------------------------- 44  Echinococcus mu...
EEB20248       1 MADRLTQLQDTINLnavQAENFCNSIGILQQFAQPGKFSGFERsgsqtpq------------------------------ 50  human body louse
Q7PTL0         1 MADRLTQLQDTVNQ---QAEHFCNSIGILQQCSVPSKFAGFERtgsqtpqqq---------------------------- 49  African malaria...
XP_002117348   1 MADRLSQLQDAVNQ---LAQHLCDSVGVLQQSAPLSYFDefeshdrgllsiqwm-------------------------- 51  Trichoplax adha...
XP_004995796   1 MGDRVTQLQELLQA---LMEHYRNAVGVLHMQAGEAAME-PAPssakkqpqkq--------------------------- 49  Salpingoeca ros...
XP_002145257  78 gqaspslgvsgaggagggetstlppgangagmpslipgqgdpnQPPVPDSPQLFLYRQKELARDLIIKEQQIEYLIGRLP 157 Talaromyces mar...
XP_009114546  47 -------------------------------------ttttttTATDGDATAAFPEQPKQLSADLVKAAKQFDALVAALP 89  field mustard
EFJ52925      49 ----------------------------------------------savshaELQVKALELSKGIAQRFKDINTIISKLP 82  Volvox carteri ...
ESS28669      55 --------------------------------------ssaspaSGEAEKRSQVESFLLRSANNVAAIMHAIETEIGNLP 96  Toxoplasma gond...
XP_004348835 117 --------------------------------------------apsgmsLQQYEEFAQTHASMIARTAKEIDVLIDSLP 152 Capsaspora owcz...
CDS38069      45 -----------------------------------ekewasnpEFQALLQSQSQEDNAHKFAVTIATTAKQIELLINSLP 89  Echinococcus mu...
EEB20248      51 -----------------------------------------------qgnqqaQEDYAQLFATLIARCAKDIDVLIESLP 83  human body louse
Q7PTL0        50 ----------------------------------vhqqqqlpqQQQQQQQPQQQEDFPQLFSTLISRCAKDIDTLIESLP 95  African malaria...
XP_002117348  52 ----------------------------qtnqilysntvsylaVHNPTTNGENVENNLDVFATLITRTAQDIDYIITSLP 103 Trichoplax adha...
XP_004995796  50 ----------------------------------pqkqqnngeEGAVASARQQVQQTVDVTKHAILQTVKDINLFCDHLP 95  Salpingoeca ros...
XP_002145257 158 GIGSSEAEQEARIRELESELRQVEQAREKKAREL-KKLGKRLELVLGTVER 207 Talaromyces marneffei ATCC 18224
XP_009114546  90 LSEGGEEAQLKRIAELQVENDLIGQELQKQLEAA-EKELKQVQELFGQAAD 139 field mustard
EFJ52925      83 DAYEPPEKQDARIGVLLHEHHALRKELGLVMQEA-ERKLEEIHGCYEAIAQ 132 Volvox carteri f. nagariensis
ESS28669      97 SSLRTREETQRRIAFLEKENDRAAKELQAVAAEA-TRVREALRQLLRhsit 146 Toxoplasma gondii VEG
XP_004348835 153 EMHVDAEDELQMFANLHKQNADAGIAFGETVNLA-EAHLTAVKQALHFVAs 202 Capsaspora owczarzaki ATCC 30864
CDS38069      90 AEEASLELQDEVTRQLLSDYRKESAKLVHLITKSfQTRLSKVRQLLSKIAe 140 Echinococcus multilocularis
EEB20248      84 NEDSSTELQVASLRRLETENQEAADRLEQVVKKG-ELLLEQIQSALADIAQ 133 human body louse
Q7PTL0        96 SEESSIELQVQSLQRLEAENKESAEKLEEIVRKG-ELLLEKIQAALSDIAQ 145 African malaria mosquito
XP_002117348 104 DIRVSQQNQEKAIERLQEENAQARQQLVEAITRA-EGVLLKVKQIKNQVAa 153 Trichoplax adhaerens
XP_004995796  96 DIKQATNTNDDDLDELHRKNAEAASLLRTKVQLA-EERLALLRGRITDITN 145 Salpingoeca rosetta
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap