Conserved Protein Domain Family
DUF2835

?
pfam11197: DUF2835 
Protein of unknown function (DUF2835)
This is a bacterial family of uncharacterized proteins. One member of this family is annotated as the A subunit of Type IIA topoisomerase (DNA gyrase/topo II, topoisomerase IV).
Statistics
?
PSSM-Id: 402669
View PSSM: pfam11197
Aligned: 48 rows
Threshold Bit Score: 82.9208
Threshold Setting Gi: 123632181
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q5QX54           3 IEYVFNLSMSYQEFCDvYYSKGYQQIVVTTVNGTRVALPAGRLIPFIDNQGVRGRFLLQVDEQQKFVGLKRL 74  Idiomarina loihiensis
jgi:Fbal_1878    2 QRYQFDLRIPAQAMLR-YYQGRAQLVVIRDRQGKVLHLHPRYLRPHLRPEGVVGSFELRLSQQGEFVELVRI 72  Ferrimonas balearica ...
jgi:Shew_1804   14 MIFTFPMQVSYQEFLN-YYQGSIDKIEVKDSSGKTLWIHARHFRPFLTTSGIRGYFRLQLDDEGKLVSLTQV 84  Shewanella loihica PV-4
BAJ01823         1 MIFYFSLNVTYHDFQQ-FYRGEVEKVEVHDHKGRTLWIHGRHFRRFLTRSGIQGQFKMELNAQGDLVSLSKC 71  Shewanella violacea D...
jgi:Sama_1587   18 LELFFRLNVGFNDFLK-YYQGDATMVEVKDIEGRVLWINARHFRPYVTRDGIQGLFRMELDKQGELQLLQKL 88  Shewanella amazonensi...
Q8EDZ2           1 MELYFKLTLSYQDFLP-YYQGLADKVEVRESQGRILWINGRHFRRFLTENGIHGQFKLVLDDKGQFVSLERL 71  Shewanella oneidensis
Q081J3           2 MEFLFSLNVSYEAFLP-YYQGLAEKVQVRDHQGRVLHINGKYFRPYLTPQGIHGQFKLVLNREGNFKSLNKL 72  Shewanella frigidimar...
Q12NG8           1 MEFYFSLRVSYDDFLP-YYQGTVSKVLVKDAQGRELLINGRYFRPFVNSLGVNGNFKLSLDGQGNFVLLELV 71  Shewanella denitrific...
jgi:Mmwyl1_1737  2 AKIVLNVALPAFKYEA-MYTGAAKNLVASSLDGRKVQLPLSAFQRFVTHQGIYGYFEVEFDDMNKLIAVTKI 72  Marinomonas sp. MWYL1
WP_013661701     2 ARIVIDVNLSAFKYKE-MYKGTVKNLVAHSRDGRKVQLPLIAFQKFVTHHGLYGSFEVEFDENKKLIGINKI 72  Marinomonas mediterranea
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap