4HN7


Conserved Protein Domain Family
PmrD

?
pfam11183: PmrD 
Click on image for an interactive view with Cn3D
Polymyxin resistance protein PmrD
PmrB forms a two-component system (TCS) with PmrA that allows Gram-negative bacteria to survive the cationic antimicrobial peptide polymyxin G. The TCS is linked to another one via the polymyxin resistance protein PmrD. PmrD is the first protein identified to mediate the connectivity between the two TCSs. It binds to the N terminal domain of the PmrA response regulator which prevents its dephosphorylation, thereby promoting the the transcription of genes involved in polymyxin resistance.
Statistics
?
PSSM-Id: 402658
View PSSM: pfam11183
Aligned: 4 rows
Threshold Bit Score: 122.632
Threshold Setting Gi: 490242963
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4HN7_A        1 MEWLVKKSCCNKQDNRHVLMLcDAGGAIKMIAEVKS-DFAVKVGDLLSPLQNALYCINREKLHTVKVLSASSYSPDEWER 79  Escherichia coli...
P37589        1 MEWLVKKSHYVKKRACHVLVLcDSGGSLKMIAEANS-MILLSPGDILSPLQDAQYCINREKHQTLKIVDARCYSCDEWQR 79  Salmonella enter...
KFD04483      1 MEWKIIDILNIPQTGLKYICI-QAFKNLKLILSVDN-DFKLQTGDTLE-ITPEGYSLNRHQAQSLKIHRMMPYCQKRWQS 77  Rahnella aquatil...
WP_004141189  1 MEWWVKKVQDNASASLCRVVL--QSGALEMIAEIEAcRLRLREGDKLTPLADARYCLNNNPTQTLKIRNATHYSSERWTN 78  Enterobacteriaceae
4HN7_A       80 QCK 82  Escherichia coli K-12
P37589       80 LTR 82  Salmonella enterica subsp. enterica serovar Typhimurium str. LT2
KFD04483     78 lsi 80  Rahnella aquatilis CIP 78.65 = ATCC 33071
WP_004141189 79 AGK 81  Enterobacteriaceae
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap