6CZT


Conserved Protein Domain Family
AlgF

?
pfam11182: AlgF 
Click on image for an interactive view with Cn3D
Alginate O-acetyl transferase AlgF
AlgF is essential for the addition of O-acetyl groups to alginate, an extracellular polysaccharide. The presence of O-acetyl groups plays an important role in the ability of the polymer to act as a virulence factor.
Statistics
?
PSSM-Id: 402657
View PSSM: pfam11182
Aligned: 5 rows
Threshold Bit Score: 243.943
Threshold Setting Gi: 145574902
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6CZT_A          2 EGALYGPQAPKGSAFVRAYNAGNSELDVSV-GSTSLNDVAPLGSSDFKFLPPGSYTAQVGQQSLPVKLDPDSYYTLVSQP 80  Pseudomonas ae...
Q88ND4         29 DAALYGPSAPKGSTFVRLYNATSAPAAASV-GNTQIKQVGAQASSDFSFLPGGDYTAQVGGKSVPVKLASDKYYTLVNSN 107 Pseudomonas pu...
WP_011921097   30 DAALYGPKAPKGSAFVRAYNASSSELDVRV-GETHLKQISPLGSSDFKFLPAGSYQAQIGNAQLPVQLQADRYYTLVSQT 108 Pseudomonas me...
Q0VSK9         23 NEGLYEMAAPPNSAFIRVINVTDEQVALAM--DDWRQSLSPGQAGDYLYRPGGAAQLQVNGKQFAFDFAKRSVQTLVFDG 100 Alcanivorax bo...
jgi:Pmen_1670  26 NADLYDPVAPANSAFVRVLNLSERNIEVTLsGKNKPQVVTSGQFGGYRFVAPGKQRIAVANQAVEHELKANTASTVIYRD 105 Pseudomonas me...
6CZT_A         81 GgKPQLVAEPPFKNKQKALVRVQNLSGSKLTLKTADGKTDVVKDVGPQSHGDREINPVKVNLALFDGSKKVSDLKPVTLA 160 Pseudomonas ae...
Q88ND4        108 SgSPKLIEEPPFKNKQKALVRVQNLSDQQLTLKTADGKTEVVKPVAANGRGEREINPVKVNLALYQGDKKVGDVKPVALE 187 Pseudomonas pu...
WP_011921097  109 GtEPRLVEEPPFTSRQKALLRVQNLTDSTLSLKTADGKTDVVADVKPDGRGDREINPVKVGLALFDGERKVADLKPVTLE 188 Pseudomonas me...
Q0VSK9        101 T-SLVPHQDTYFSSRLKALLVMYNLSTQPATLQTSNGAVNVIGPLPAGSSDERQINGVKVSLKVVLDSGVELPLEEVVLQ 179 Alcanivorax bo...
jgi:Pmen_1670 106 G-QLLLIADQFVNEPRKAQIAFYNLTDKPAALKTVDGQHVVVDTIQRDQTGSRMVNELKIAFAAYADDEQLVGFDELFLK 184 Pseudomonas me...
6CZT_A        161 RGEVVC 166 Pseudomonas aeruginosa PAO1
Q88ND4        188 RGEAAV 193 Pseudomonas putida KT2440
WP_011921097  189 RGEVVS 194 Pseudomonas mendocina
Q0VSK9        180 RGRVYT 185 Alcanivorax borkumensis SK2
jgi:Pmen_1670 185 KGRSYS 190 Pseudomonas mendocina ymp
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap