Conserved Protein Domain Family
DUF2967

?
pfam11179: DUF2967 
Protein of unknown function (DUF2967)
This family of proteins with unknown function appears to be restricted to Drosophila.
Statistics
?
PSSM-Id: 402654
View PSSM: pfam11179
Aligned: 2 rows
Threshold Bit Score: 1064.65
Threshold Setting Gi: 968111228
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_002034570  25 PDRYVPGSPIFREtSSPTPHPALAGPITSPPTSASSSASTSTAADSTAsstitapgagpggtSTTRSRGaRAMTASLAHA 104  Drosophila sec...
XP_002050784 138 PERYVPGSPIFRD-SSAPPNATPSTPITAAPTGAAAAAATTTSTASAS--------------PTSRSRG-QAMTISLSHA 201  Drosophila vir...
XP_002034570 105 AQGNHNNNSSTRSTsnSSSNTGKSKP-PAGYMSTRSAAMMALALGQTSGGRSDKTPQAPRAASPAqsqsqsqsqsqSPH- 182  Drosophila sec...
XP_002050784 202 AQGNATATKSTTNN--SSNNNNKPKPlATCYMSTRSAAMMALTLGQQSSEKKSSKPASGKQTTSSsss------naSPRt 273  Drosophila vir...
XP_002034570 183 ---------PGAtRRLSNAS-----------------SLPSNVSRSKPSTPTATRAAAQLNGSSLFSGGSNSSGSDNDGF 236  Drosophila sec...
XP_002050784 274 nnravsmtrPAN-RSTPTPAamsnvnaanstctatatSTTTSRATSKPSTPTAVRAAAQLNGMGILSGGSNSSGSDNDGF 352  Drosophila vir...
XP_002034570 237 SASGSSAATALRRLYFKSGRSIKNKINASTTSsTPLNGLPLNPVSSAYHNSVGG--PMHNMTTaGGVPKLVVMGTSSASI 314  Drosophila sec...
XP_002050784 353 STSGSSTATALRRLYFKSGRSIKNKINSSTSS-TPLNNLPMNAVSNAFHNSVSGatAMHAMGV-SGVPKLVVMGTSSASI 430  Drosophila vir...
XP_002034570 315 PDTTINTSTDSACTLITNVTHTDTSETCDSLDMGDNSGPSEPLFSSLEEPLLTAVHIDSEHEgfggmGGgrggangrgAT 394  Drosophila sec...
XP_002050784 431 PDTTINTSTDSACTLITNVTHTDTSETCDSLDLGDNSGPSEPLFSSLEEPLLTAIQIDSEHE-----AG---------GT 496  Drosophila vir...
XP_002034570 395 ELELTSCSRYPPRPDMNLQDSVESQESCLSILTGEPSSTTPLLSSqrrhptgghspgsqrqeerrerkEREPSTAPPPTR 474  Drosophila sec...
XP_002050784 497 ELELTSCSRYPPRPDMNLQDSTESQESCLSILTGEPSSTTPLLVS-----------------------SRQPSTAPPPTR 553  Drosophila vir...
XP_002034570 475 VREHFTFDPPQSPKSARSSEKSTSHFSFKNY---GNESAKDAGVGSgkgtgsvvgggggsgsgvggngvMAASEGDEEDD 551  Drosophila sec...
XP_002050784 554 GREHFTFDPPQSPKSARSSEKARSHFTFKEEtqqARRASSSHYTGS-----------------------ATTAEADEVHE 610  Drosophila vir...
XP_002034570 552 ERsgdSIGNRSKKLRPRERDT----------------NHISPSVSPSHSRRASPKREKRRTMPIASTGAISKVSSAPPTM 615  Drosophila sec...
XP_002050784 611 ER---LAANRNKKLRARERDTmnanggggggsagstrNRISPNVSPSSSNRTSPKRERKRTTPSASTGAIAKINSAPPTM 687  Drosophila vir...
XP_002034570 616 KDANFFGSSGKQKQRQSQNIPPHQLSPSS----QQRKYSSSSSSGSSERCLREATGPGTMFPFDREALDYERIQRECFAP 691  Drosophila sec...
XP_002050784 688 KDGNFFGSCQNQKQRQSQQQQQQQLSPSSsasaQQRKYSSSSSSGSSERCLRDAAAGGTMFPFDREALDYERIQRECFAP 767  Drosophila vir...
XP_002034570 692 SSTTASNSSDS-EAENCSVYERKSGADIFQQYSRLSHQEQlQQhyQ-EQRDWERDR--------PPSRKNSKRIRPDSVI 761  Drosophila sec...
XP_002050784 768 SSATASTSSDSeEGENCSVYERKLSADIFQQYSRLTQQEQ-QQ--QqHQLNHERDRdwdrererPPSRKNSKRIRPDSVI 844  Drosophila vir...
XP_002034570 762 HTTIRENQQYVPQSDAFYPQAKSSSSPSDHSYAELNKFEDIASKFEQIPPKHgsvsgsGSGSLLN---LHhkMPSPGSES 838  Drosophila sec...
XP_002050784 845 HTTIRENQQYVPQSDAFYPQTKSSSSPSDHSYAELNKFEDIASKFEQIPPKH------GSNSTLNlqmLH--MHSPGSES 916  Drosophila vir...
XP_002034570 839 ----AVSPTDSTRRRSFKNKQRHQKEEHFYIqtEDr----sGTAAGNGPINVTANPLEAAAVCKQPRATIVVQQ 904  Drosophila sechellia
XP_002050784 917 lasaSLSPTDTTRKRSFKSKSKSKTQTQLQA--QAledllpGSGSSAGAINVTANPLEAAAVCKQPRATIVVQQ 988  Drosophila virilis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap