Conserved Protein Domain Family
DUF2938

?
pfam11158: DUF2938 
Protein of unknown function (DUF2938)
This bacterial family of proteins has no known function. Some members are thought to be membrane proteins however this cannot be confirmed.
Statistics
?
PSSM-Id: 402637
View PSSM: pfam11158
Aligned: 14 rows
Threshold Bit Score: 155.56
Threshold Setting Gi: 148499891
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
jgi:Sama_3348   8 LIIGVGATLMMDLWAGLRLRLFGVPSLNYAMVGRWLLWIPKGRFIHRPIASSESQ--QGEVLVGWLAHYAIGITFAGLLL 85  Shewanella ama...
Q6F8H9          7 IFVGCGATLFMDAYSFILKIYFGVQSLDYRVIGRWLIYLSKAKFIHHTIMQTPEV--KYEKVFGWLSHYLIGILFSAIFF 84  Acinetobacter ...
Q0KFL6         13 IVIGTGATLVMDAWAILRKRLLGVPALDYGLVGRWLAWLPRGRLCHHPIAASPPV--RGERGIGWIAHYLTGIVFAAILL 90  Cupriavidus ne...
Q63Z05         12 LAIGVGATAVMDAWALVRKRCFGVPPLDYALVGRWLGHLARARVRHAPIAASPRV--PGERAIGWAAHYLIGVAFAALLL 89  Burkholderia p...
jgi:Mpe_A2683  11 VLIGAGATAVLDAWLLVLRRA-GVPGLDLAHLGRWAGHLLHGRFRHAAIARSAPV--AGERAWGWLAHYAIGIAFAAALV 87  Methylibium pe...
Q88F27         34 lPIGIGATVVMDLWGLLLRRL-GIATLNFAMVGRWAGHLLGGRVSHQAIAKAEPV--QNELAWGWVIHYATGVLFAMLLV 110 Pseudomonas pu...
jgi:Swit_1783  10 LCAGVAGALVFDIWNWLIEKVAGIRAPRWAILGRWL-------LAPLGCGGEGPVftPAERWLGTFAHYATGVAFALGLI 82  Sphingomonas w...
Q16AV9         37 IVMGLVATAAMDLWGLLLNRLVGLPMSNWGRAGRWVVQVAQGRVFHDDIGAVPPV--PREAQIGWAFHYAVGVIYGVALA 114 Roseobacter de...
Q2K8K3          9 LVIGAGATILMDLWAIVLTKVFGQTPPNWAPVGRWFWHLGRGKVFHENIADAAPY--ANELALGWISHYAVGILYGVIFA 86  Rhizobium etli...
Q7CXP7         19 IAMGIGGTVFMDIWAIILHRFFGQSAPNWAPVGRWFWHVPKGRIFHDSIATATPY--EHELALGWISHYAVGILYGIILA 96  Agrobacterium ...
jgi:Sama_3348  86 PFAGAEwfTEPSAGPAVALGLVTVAAPFFLLQPVLGMGMAASRAPNPWGTRAHSLITHAVFGLGLYLSALVS 157 Shewanella amazonensis...
Q6F8H9         85 QYTINH--PSPTLLSALTFGLVTVVIPFLIIQPCLGFGLAASKMPLVWIARFKSIGHHLIFGLGLYLSFQIY 154 Acinetobacter baylyi
Q0KFL6         91 GLWGLDwaHHPTLAPALIVGIGSVAAPFLLMQPAMGAGIAASRTPRPNVARVHSLVTHAVFGLGLYVAGWVV 162 Cupriavidus necator H16
Q63Z05         90 ALRGVGwaGEPTLAPALAVGIGSVAAPLFVMQPAMGAGIAASRTPRPGAARFHSIVAHAVFGAGLYGAGCAa 161 Burkholderia pseudomallei
jgi:Mpe_A2683  88 AIEGWAwvREPTLMPAVAFGLLTTLTPLAILQPAMGAGFAASRTPTPMKNRLRSLANHTVFGLGLYLSAAIA 159 Methylibium petroleiph...
Q88F27        111 VIVGEGwlRSPTLLPAVVVGVGTAVAPLCFMQPAMGAGFFSSRTPTPARNCLKSLATHFVFGVGLFLSAGLl 182 Pseudomonas putida KT2440
jgi:Swit_1783  83 LAMGPGwiARPTLAPALVAGIVTTVFAWFVIMPALGAGIAGARIPRPNRQRVATLVAHAMMGAGFYAGAVAV 154 Sphingomonas wittichii...
Q16AV9        115 LLMGPGwlAAPTLGPAWVFSIVMIGFGWFLMQPAMGAGLAASRTPTPWRARALGLAAHTVFGLGLWVGA--M 184 Roseobacter denitrific...
Q2K8K3         87 IIMGQEwlAAPTFLPAWIFGIVTVGAGWFLLQPGLGLGWAASRHPKPMKVRCFNLLAHTVFALGLYGTALII 158 Rhizobium etli CFN 42
Q7CXP7         97 LVVPAAwfANPSFIEPWIVGIVTVGAGWFLLQPGLGIGWAASKTPNPTKVRILNLVAHTIFALGMYAVALLM 168 Agrobacterium fabrum s...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap