Conserved Protein Domain Family
EIAV_Rev

?
pfam11129: EIAV_Rev 
Rev protein of equine infectious anaemia virus
The sequence of this family is highly conserved and carries a nuclear export signal from residues 31-55, and RNA binding/nuclear localization signals of RRDR at residue 76 and KRRRK at residue 159. Rev is an essential regulatory protein required for nucleocytoplasmic transport of incompletely spliced viral mRNAs that encode structural proteins. Rev has been shown to down-regulate the expression of viral late genes and alter sensitivity to Gag-specific cytotoxic-T-lymphocytes (CTL). Equine infectious anaemia virus (EIAV) exhibits a high rate of genetic variation in vivo, and results in a clinically variable disease in infected horses.
Statistics
?
PSSM-Id: 151573
View PSSM: pfam11129
Aligned: 2 rows
Threshold Bit Score: 226.446
Threshold Setting Gi: 82295782
Created: 11-May-2020
Updated: 6-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q8AGS8   2 PQGPLESDQWCRVLRQSLPEEKIPSQTCIARRQLGPGPTQHTPSRRDRWIREQILQAEVLQERLEWRIRGVQQAAKELDE 81  Equine infectious ane...
Q992J2   2 PQRPLDNDEWCRILRQSLPEEKIPSQTCIARKHLGPGPVSCVSGRRDSWLRGQVQHAEALQEQLEWRIRGVQQTAKELEK 81  Equine infectious ane...
Q8AGS8  82 VNRGIWRELHFREDQKGDFSAWGGYQRAQERHWGEqSSPRVLRPGDSKRRRKHL 135 Equine infectious anemia virus
Q992J2  82 VNKEIWRELQYTRRQHGDYGSFCDYRRREEERWGE-SSPRVLKPGDSKRRRKHL 134 Equine infectious anemia virus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap