Conserved Protein Domain Family
Pho86

?
pfam11124: Pho86 
Inorganic phosphate transporter Pho86
Pho86p is an ER protein which is produced in response to phosphate starvation. It is essential for growth when phosphate levels are limiting. Pho86p is also involved in the regulation of Pho84p, a high-affinity phosphate transporter which is localized to the endoplasmic reticulum (ER) in low phosphate medium. When the level of phosphate increases Pho84p is transported to the vacuole. Pho86p is required for packaging of Pho84p in to COPII vesicles.
Statistics
?
PSSM-Id: 402616
View PSSM: pfam11124
Aligned: 28 rows
Threshold Bit Score: 279.133
Threshold Setting Gi: 238033808
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
EDK43680       4 QKDIDLNKPLDESAPATLSKSTLTPNLTRATTTLHGDRFKQAQAQLSRFVLLHPIAVSVYTIFFPSIIGRSLWEYIEISD 83  Lodderomyces el...
EEQ38394       4 QVELNLSTPLKAEADPTIKPIPLEPALATAALTLHGDFYRQLQSKANHHIFWHPITQFVLTSTLCGFAYYTYSELIEISD 83  Clavispora lusi...
XP_001385214   4 QKVVDLNKPLDADAKATLEKSSLKPELAQAALALHGDRYRQLQSRLNRFLFWHPVFIIVFSIAIPTVLTYKLWDYISISD 83  Scheffersomyces...
EGW33141       4 QKEVDLNEPLDAHEAPTLSKTPLKPEFAKAALILHGDTYKQLQAKLNRFIFWHPIAIIAYFLLIPAALLYNLWDFVEVSD 83  Spathaspora pas...
EER34816       4 QKELDLNKPLDSNAAPNLGKTILTPELSKSAIVLHGDRYKQLQAKLTKYVLWHPYAMLAMTTVVPIIFFYSVWDYVSISE 83  Candida tropica...
EMG47136       5 QKDLDLNKPLDVNIPPTLGKTSLTPELSKAAIVLHGDHYKQLQAKLTKYVLWHPYAVILYTLSIPLVIGYGIWEYMIVCD 84  Candida maltosa...
EGV60253       4 QTKIDLNKPVKSAPDPKLEVVALRPEFSEAALLLYGDYFRQCQTTLTKSILWHKQVVSIGLGVVSAYLYYILADYIEVSE 83  Yamadazyma tenu...
Q6BUK3         4 QKDVNLNEPLNDKIPPTLGKTSLTPELSQAALILQGDYYSQLQGKCNRYVFWHPISTTFLVISTSIFTYYRLYDYISVSE 83  Debaryomyces ha...
XP_004194708   4 QKEVNLNVPLDVNKKATLSRTELTPDLAEASLVLHGDYYRQLQGKCNKYLFWHPLSLFILISGGLSFFLFRVREWIEVAD 83  Pichia farinosa...
EDK39636      18 QKFVDLNEPLNPEAKPTLAKSSLTPEYAEASLILHGDYYRQLQGSCNRYIFWHPISMSIWVVGLVAAAAYFLRDYYAISN 97  Meyerozyma guil...
EDK43680      84 TALELFWLLVRNkrdfvfaLISAIPIIAAVFATFGTLAYFLGDELGTIANQFVQKKYCDLIFGFNVREFASIEDDfegnn 163 Lodderomyces el...
EEQ38394      84 SIPEFLFLAWNNky----lVSSFFPVIIFLIGTIGIISFLVTDEFRVVSDSLTDDATMSKIFRFPLRIYANYDENdksqn 159 Clavispora lusi...
XP_001385214  84 SPVELLSFLIKSndf-rfqILASLPLLAAVMGFVGITCFWVSEELRYISDKMIQEGFAGEIFGFNIKTFSELPSEptttq 162 Scheffersomyces...
EGW33141      84 SAWEFFLLGKKNpkdfiygIIAAFPMVAGIFATFGLITYIMGDDIGNITSAFVAQKYCDKVFGFDIKKFAQLTGHetdvd 163 Spathaspora pas...
EER34816      84 NLLEFYHLVKKDkkdfifsILSAFPLFASIFGIFGFLAYIVGEDMG-IASKNFAQKYCDYVFGFNIRAFAKNDNNedkkl 162 Candida tropica...
EMG47136      85 SLIEFYFLIMRNkkdfifaIFSSFPILASIFGCFGFLAYVVGEDMGIITSKFYAQKYCDSIFGFDIKAFSQNENNkdkkl 164 Candida maltosa...
EGV60253      84 SVGEFFSIAIHSadl-kvnILFTSAVILGFIAFVGLISVMISDEFRIISENLVKKSYVEDVFGFDLVKYSKLEGDskvlk 162 Yamadazyma tenu...
Q6BUK3        84 SFGEFFSFFIKSrdf-qfqVMGIFPWLVCVFGIVGIVTHFVSDVYKDISVKLPQLKYIEKIFGFNLKEYARLSQStllkq 162 Debaryomyces ha...
XP_004194708  84 SIGEFFKFFIKSrdf-qveIFKTFPLAISIFGIIAVIAFMLSDVFRVISDDLPKPEYSHALYGFDITKFANSGEMkltpk 162 Pichia farinosa...
EDK39636      98 GLLDFFAQFVARsdm-kfeLIYLLPCTVLIFAFIGLSAHLLSDDLRDIADKLDQPDRIEELYGFDLRKFAKEDPNsrlsp 176 Meyerozyma guil...
EDK43680     164 nsnsnsnsnddndgvevktkeknnqkrklnksqmkanlekgKNSEVVSYRGSPIAVASVVPDYEQSKPDYFIIKITGVHV 243 Lodderomyces el...
EEQ38394     160 sl--------------------------------afiesasQSTELIEYRESPIAIVTVIPLPDKSTSEVFYARITGLHV 207 Clavispora lusi...
XP_001385214 163 dv---------------------------------klyengVNTQIILYRDSPIAICTVTPDLVNSTVENFIVKISGLHI 209 Scheffersomyces...
EGW33141     164 si---------------------------------kllkkgLNTQIIMYRESPIAICTVVVDEEQSTPESFIVEITGLHV 210 Spathaspora pas...
EER34816     163 -------------------------------------aklgQNTELIIYRESPIAVGSLVVDEDQSTVENFVVKITGVHV 205 Candida tropica...
EMG47136     165 -------------------------------------aklgKNTELIIYRESPIAIGTLVVDEEQSTTSKFVVKITGIHV 207 Candida maltosa...
EGV60253     163 ek---------------------------------kilangSNSQVVLFQEQPIAIITLKPIYDKSNDSHLVIKVSGLSV 209 Yamadazyma tenu...
Q6BUK3       163 krklt--------------------------pkevvflkngANTHIVMYRDSPIAIITLIPLLDESSETEFVIKITGLHV 216 Debaryomyces ha...
XP_004194708 163 e----------------------------------kaafhgDYTQIIIYRDSPIAVITLRPLLDVSTDSNFVVRITGLHV 208 Pichia farinosa...
EDK39636     177 kq--------------------------------kallqngENTHLIVYRNSPIAVITLKPLLDNSTEANYFVRITGLHV 224 Meyerozyma guil...
EDK43680     244 RKVFQKVDFDQMLIEWAVLRSRQLYQDFLKnghhntsrvKDGSILITIDAYSFDKHFEKLLAKNGFKAIDVNYTVNALdk 323 Lodderomyces el...
EEQ38394     208 RKVYAKAGLQNELMEIAKLKAKSLCSRYVAdnk---iktKSMRIVLLAEGYTTDSIMTKIFKENNFKALESTTNVNPFsd 284 Clavispora lusi...
XP_001385214 210 RKVFAKVDFDDLLIDWSIFRAREIYQDYVKskn----------lkIVVDSYSFDKKFESTLLAKNFVIVDESLELNPYke 279 Scheffersomyces...
EGW33141     211 RKVFENVDFHELLIEWAVLRTRELYEEYAKqkk---vktQEGTILITTDAYSFDKRLQTCLYNTNFGVMSKDVELNRFsd 287 Spathaspora pas...
EER34816     206 RKVFQKVDFDEVLIEWAILRTRELYQEFLVsngl-kappENSSILITADTYSFDPEFQKTLQENGFRPIDVSFQLNPFds 284 Candida tropica...
EMG47136     208 RKVFQKVDFDVVLIEWAILRARELYQEYLTsqnv-ktppENSFILVSMDAYSFDGAFEKTLLNNGFKLLDVSYELNPFsp 286 Candida maltosa...
EGV60253     210 RRVFKPLNFEQILIEWALSRSNDLLTEYLKakkv--kktSGCKVSLLVDCYTFDTEFAKFLESNRFNKIDSTYNYNPIge 287 Yamadazyma tenu...
Q6BUK3       217 RKAFVKVDFDVLLLEWSYDRARDILKEYGPnk--------dAKITLLADAFSFDNLLIKTLENQSFQKISSSFTLNSFed 288 Debaryomyces ha...
XP_004194708 209 RKVFAKADFETLMLEWSFTKARQIFQQHVKks-----kvAGCKIQLLIDAFSFDRFYINALTKNSFGKVSSSYVLNPMva 283 Pichia farinosa...
EDK39636     225 RKVFVKADFHTLLIDWALLRSRQLFHEYSKkks----dvDSCKINILVDAYSFDKTYIKFLQSRSFGRVSSSTLLDkskk 300 Meyerozyma guil...
EDK43680     324 dkkv------------griyelL-YKLFGISTDTFALI 348 Lodderomyces elongisporus NRRL YB-4239
EEQ38394     285 kqsadti-------lklipvsfL-MKIFGIYRVTYELE 314 Clavispora lusitaniae ATCC 42720
XP_001385214 280 vst--------------kiqklI-HSFFGVSRRTLELD 302 Scheffersomyces stipitis CBS 6054
EGW33141     288 tln--------------kpkeiL-HKLLGVSRDTFGLA 310 Spathaspora passalidarum NRRL Y-27907
EER34816     285 avy--------------gfkerI-YKFLNVCRITFGLM 307 Candida tropicalis MYA-3404
EMG47136     287 sgs--------------nlmkrV-FKLLNVSRDTFGIM 309 Candida maltosa Xu316
EGV60253     288 ita--------------plkglL-NKTFRSGRDTYGVH 310 Yamadazyma tenuis ATCC 10573
Q6BUK3       289 dsesktg------ilsyitstgA-YKTFGITKDTYRLT 319 Debaryomyces hansenii
XP_004194708 284 ketkksdkpvssqgilakissmLtHKVFNISRDTYGVT 321 Pichia farinosa CBS 7064
EDK39636     301 gs---------------nliqsL-NKLLGITRDTFGVT 322 Meyerozyma guilliermondii ATCC 6260
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap