Conserved Protein Domain Family
DUF2624

?
pfam11116: DUF2624 
Protein of unknown function (DUF2624)
This family is conserved in the Bacillaceae family. Several members are named as YqfT. The function is not known.
Statistics
?
PSSM-Id: 402612
View PSSM: pfam11116
Aligned: 18 rows
Threshold Bit Score: 82.3059
Threshold Setting Gi: 503253566
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CCG45886                1 MKqVAQQFVMQKLKQLTVHDLMSYSKQYTIPISKSEAELIVKALRKNKENPFEPNGRKRMLTKLAAITSKDTARSVNRLL 80  Haloba...
Q5KX28                  1 MN-IYQQLVKQKLKTITPEELVAYSREYGLPITTSQAKQILHLARTNDINVFDPEERKKWVRELAKITSPDIARKANELF 79  Geobac...
jgi:GWCH70_2405         1 MN-LYQQLIQQKIKTITPEELVSYSHDYDIPLTVEQAKKILHIARTNKINVFDPQERKKWVKELAKITSPQTAKKANELF 79  Geobac...
WP_013488227            1 MNpIVRQMVNQKIRNLTVKELIKLGRENNISLTVKQATAVLNILQDQPFDIGNKNIVLNVNNQLKQL-DPALYKKARQLL 79  Bacill...
Q9KD32                  1 MNpFMIQMVNQKLNSLTAPELLQLAKQYGIPLTGNQAKDVIAILRSESVDVGNEAQVKRLIERLQQETDPQLAQTINQLL 80  Bacill...
ADC50807                1 MNsIMQQLVNQKVNSLTAGELMQLSSQYQIPLTKEQAEGVINVLREEQIDVGNADQVNKIIQKLQTEVDPHVSSIVTQLL 80  Bacill...
Q5WHC1                  1 MNiIMQQLINQKINSITESEFIQLAHKHGYQVTPAQTKAIFKIIKAQRIDIGNRSQIDQILERLRTETDPYIAGVVDELF 80  Bacill...
Q8EPZ3                  1 MSfFIKEMVKSKVRNLTVGELLHYSKQYNFHITEPQARQIINYLRTNSPDPFKASDRDRMFHELSTITDPQTAKQAQALM 80  Oceano...
BAM47260                1 MNpFLKNIVRKKLTEVTPNELIIQARNYNVELTQVQAVQIVKILSRKDLDPFKKTDLASLLKQLEQITDQTTVKKAKIIL 80  Amphib...
PRJNA212797:N288_18290  1 MK-IFENIINHKVSTITTEELLKYAKQFQISINQTQAKQIANYLRGKQVNIFQDSERSKIIKEIAKIAGPDTAREVNKLF 79  Bacill...
CCG45886               81 MELA 84  Halobacillus halophilus DSM 2266
Q5KX28                 80 LKFV 83  Geobacillus kaustophilus
jgi:GWCH70_2405        80 LKFI 83  Geobacillus sp. WCH70
WP_013488227           80 KPYe 83  Bacillus cellulosilyticus
Q9KD32                 81 TQFS 84  Bacillus halodurans
ADC50807               81 QQFG 84  Bacillus pseudofirmus OF4
Q5WHC1                 81 EQFQ 84  Bacillus clausii KSM-K16
Q8EPZ3                 81 DEVI 84  Oceanobacillus iheyensis
BAM47260               81 NQFI 84  Amphibacillus xylanus NBRC 15112
PRJNA212797:N288_18290 80 MQFT 83  Bacillus infantis NRRL B-14911
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap