Conserved Protein Domain Family
DUF2623

?
pfam11115: DUF2623 
Protein of unknown function (DUF2623)
This family is conserved in the Enterobacteriaceae family. Several members are named as YghW. The function is not known.
Statistics
?
PSSM-Id: 371383
View PSSM: pfam11115
Aligned: 5 rows
Threshold Bit Score: 138.343
Threshold Setting Gi: 506350695
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P64574           1 MNNHFGKGLMAGLKATHADSAVNVTKFCADYKRGFVLGYSHRMYEKTGDRQLSAWEAGILTRRYGLDKEMVMDFFRENNS 80  Escherichia c...
WP_002916743     1 MENHFGKGLMAGLQASYADTAAHAANFCADYKRGFVLGYSHRMFEKTGDRQLSAWEAGILTRRYGLDRDMVMDFFKEGGS 80  Enterobacteri...
Q6DB41           1 MGNHFERGVLAGLRSANPKSTNDINPYCYDYRRGYICGYAHHLAETKGDRQQAAFEAGLLSRRYGLERERVAEFFTEQGN 80  Pectobacteriu...
WP_015870414     2 gKNHFGDGVMDGVKCYEPCGAGEMRRRCFDYRRGYVCGFSYSFARRIDNRYMAACRAGERARLYGLERDAIAGFFLSGED 81  Edwardsiella ...
IEC:ABF-0016213  1 MKNHFGDGILAGLQASTPQSMSDIRHYCDDYRRGYVCGYAHQRASLRG-RQQAAFEAGQLCRRYGLMRDIVAEFFTDVSN 79  Dickeya dadan...
P64574          81 CSTLRFFMAGYRL 93  Escherichia coli K-12
WP_002916743    81 GMAMRYFLAGYRL 93  Enterobacteriaceae
Q6DB41          81 PYAIRFFYAGYDA 93  Pectobacterium atrosepticum
WP_015870414    82 SQLQRYYYTGYER 94  Edwardsiella ictaluri
IEC:ABF-0016213 80 PSLVAWFYAGYNQ 92  Dickeya dadantii 3937
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap