Conserved Protein Domain Family
FANCF

?
pfam11107: FANCF 
Fanconi anemia group F protein (FANCF)
FANCF regulates its own expression by methylation at both mRNA and protein levels. Methylation-induced inactivation of FANCF has an important role on the occurrence of ovarian cancers by disrupting the FA-BRCA pathway.
Statistics
?
PSSM-Id: 402607
View PSSM: pfam11107
Aligned: 23 rows
Threshold Bit Score: 207.974
Threshold Setting Gi: 1002844613
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_001636561   1 MEEVIKNTHAYVDVLVM-ARGDAVITWEKETFERAFKWARYFEGVYTKLKSKPALAEKLNKYLNNFNKTESVFLGNL-KL 78  starlet sea ane...
XP_005809971  10 MEAVLKNVGCTVELLAVaAHSGVVNEWDEQTVTRAFHWARYCEHIYSRFHGNPVIRGVLEKQLQLTNHRLKEAFPEYnAV 89  southern platyfish
XP_004070011   1 MEAVLKNVASAVELLAVaAYSDAMSQWDEKTLSRAFHWARYCEHVYTRFHTNSAGRRVVEKQLQHTNARLRDAFADYrEV 80  Japanese medaka
4_pfamImport   1 MEAVLKNVAGTAELLAVaSLSGEVERWEEPTVSRAFQWARYCEHLCRRFHDNPAIRRVIEKQLRVTNHGLRAAFAGYgDV 80 
XP_005450884   1 MEAMLKNLASTVEMLAVaAQSDAVKHWDKQTLSRAFHWARYCEHVFSRFHNNAAIRRIMEKQLQLTNQTLRDTIPGYtEV 80  Nile tilapia
XP_007228290   1 MEAVLKNLGSTLEVLAV-SETEFVREWDARTVDRAFQWAKYCEHVYNRFHANPSIRPVLEDCLRLTNERLSEGLSGHrAL 79  Mexican tetra
NP_001038699   1 MEAVLRHLNNILELLAV-SRTDRVREWDRPTTQRAFKWAEYCEQLHSRYQSNPTVRSSLESGLTDTNRRLKETFPSYsPV 79  zebrafish
XP_006011742   1 MEALLENLTRFCEVLAV-ARSDYVSEWDSRTLHRAFQWADYFQHICGRFGANAPVREALERRLRLANESLSRNFEGYrFL 79  coelacanth
XP_012823448   5 MHTLLENLDRYIEVLTL-SQSVHVKDWDISCVRRGFEWGTYFQQVYHRFHTNECLRNALEDHLRSKNETLSACIKNYqYI 83  tropical clawed...
XP_030129162   1 MDAVLRQVEQLPALLAV-SRSAQVRHWDCLTLDRALEWARYFQHLHHRFRARPQLREALGRRLRRSQPLP--------VL 71  zebra finch
XP_001636561  79 TFKSLQISGKILKQFLLQNPHISSEQFPLVIMLYSvIIGGANEQD-TTDLTEDLVRI---CQLKGCMSVL---------S 145 starlet sea ane...
XP_005809971  90 SFLDLGRCQDLLLLWLLNNSALPISIMKMLFETKA--SADSTSSD-YEDVRGLCNQI---IQCKSACTVL---------R 154 southern platyfish
XP_004070011  81 SFMDLPRCEHLLLLALLSNPHLPISTMKILFGKKD---VASRYYD-YKEVTGLCSHL---IQCKSACKVL---------C 144 Japanese medaka
4_pfamImport  81 SFSDLYRCQHLLLVGLLKNPQLPISVMKILFDA--------EQSE-YQEVTGYCSRI---IQCKSACKVL---------S 139
XP_005450884  81 SFSDLPRCQHLLLVRLLNNPELPSSLMKMLFDTAR--PVKTMHGE-YEDVTGLCSHI---VQCKSVYKVL---------S 145 Nile tilapia
XP_007228290  80 SLADLAQCRHRLFIGLLRNPLAPHSVFKSLFDNCR-LFEDDGDTKpGRETHLDLSGL---IMCRSACKLLgs-----fqL 150 Mexican tetra
NP_001038699  80 EFSELAQCQHKLIVYLLRNPSSPHFIIEMLFPDQNs---------pSQELLAAQNSL---VTRKSAFSLLcc-----tvN 142 zebrafish
XP_006011742  80 SFEALRRCGETLRLSLLGNPAVSQSLYPRVLAGLE-----------DRASLEDLRRA---VGQKAAARVLfeagaasrsR 145 coelacanth
XP_012823448  84 TFNDLRYGKEIFCMSLLQNKALSKDIFQYIVRQLKnl-------ssGETSICSMSNI---MCQKAALQLLlf-----ssS 148 tropical clawed...
XP_030129162  72 GFPALGRCPQLLGLALLENRALPPAACRCLLRSLL-QPPAGGS-G------RDPGGLpllARRKAAACLLas------gP 137 zebra finch
XP_001636561 146 DMRck------------lsDDLLVMTKrndeqsnghlsdneyryntarelkwadigcltvddvgimslAEMLFNYVYHNL 213 starlet sea ane...
XP_005809971 155 PLLgv------------psVGADAEVQ-----------------------------------------GEMLMERLGSAL 181 southern platyfish
XP_004070011 145 PFSgl------------saVDADAEVQ-----------------------------------------GEMLMKRLDALL 171 Japanese medaka
4_pfamImport 140 PLAds------------saVGADAEVQ-----------------------------------------AEMLMERLGALL 166
XP_005450884 146 PLAdm------------saLGADAEVQ-----------------------------------------GEMLMERLEALL 172 Nile tilapia
XP_007228290 151 NSQet------------sdISFSTQVQ-----------------------------------------GLMLLQRLHAIQ 177 Mexican tetra
NP_001038699 143 RTSsy------------ygLQTEPEVR-----------------------------------------GKLLGKLLNSIL 169 zebrafish
XP_006011742 146 TPDel------------pgADPVARTD-----------------------------------------AALLIQYLNDRQ 172 coelacanth
XP_012823448 149 IASkn------------plENPCVVTQ-----------------------------------------AEILKNHLENRI 175 tropical clawed...
XP_030129162 138 GPQgqlqaearlllgrlreEGQGAEAQ-----------------------------------------------LLREEG 170 zebra finch
XP_001636561 214 T---CSGKDVKSLQKKLLHFAsQ-ANGLQVIASCLaFIpAGIQQLSQaG--------------------PVHKFLLNFLe 269 starlet sea ane...
XP_005809971 182 SqssDPRRVEDFLSSVLQEFEvAaEHLCPVIAAAL-LT-TDSAVQTA-----------------------SQDFLLDWL- 235 southern platyfish
XP_004070011 172 SqgsDPQQAEHFLHSVLLLSEeAaHHSCLVITAAL-LTaSDSGTQTS-----------------------SQSFLLNWL- 226 Japanese medaka
4_pfamImport 167 SrggEAR---HILDSVPQGFEgAaGHFCVVIAAAL-LMkKNS----------------------------SQDFLLDWL- 213
XP_005450884 173 NqgsETCRAEHFLGSVLQGCEgAlQQFCVVIAAAL-LTsKNCAAQTA-----------------------AHDFLLDWL- 227 Nile tilapia
XP_007228290 178 ChpgNDSYLRKLMDTFLQDVGqDlDHLFEVIAACL-LIeNETSEEHTa----------------------AQDFLLDWLq 234 Mexican tetra
NP_001038699 170 ArpgNEEHAKCLLDSVRCNSAgKvDGFYDVIAGAL-LCsSDE----------------------------SQRFIITWL- 219 zebrafish
XP_006011742 173 RrldSSGDRERLVEVALGKLAgS--QLWPVLAAVL-------------Tdda---------------ggVAVDLVLSWL- 221 coelacanth
XP_012823448 176 Rl-lKGDHQFAVVADVLSGIP-Q-PSVYKILAVLL-LSsETCDSQGQv---------------------SLSHLFLKWL- 229 tropical clawed...
XP_030129162 171 Q---ETAGQPRWLRGALEQLP-Q-PRACGVVAAALaLLaQGCDTEQTgDadraasssqggyqagaagdgCAAGFLLSWL- 244 zebra finch
XP_001636561 270 g-yLCNNSVAANFWQ-LPLRILSCVSFKYDSILNMYLNHLLGWgqhmipvislqqcgntrtKSCQVY-----Q-WrykTS 341 starlet sea ane...
XP_005809971 236 ---QSRRGVLQHVCTaLPSKVLADLAERHQKFRDAFCKLLKKW------------------ASEMEYrvtegE-W---VH 290 southern platyfish
XP_004070011 227 ---QKEHGMLQHMGStLPSAVLKDLARAHGKFRDAYFSALKKW------------------ASEMEYslndgE-W---LP 281 Japanese medaka
4_pfamImport 214 ---QKEQSVLEQMCSsLPSALIIELTKKQPKFRDAFCDLLKKW------------------ASDMEYslsegE-W---IQ 268
XP_005450884 228 ---QKNHSLLQHMCSlLSPTLLRDLAKEHQKFRDAFCNVLKKW------------------ASEMEYslndsE-W---VL 282 Nile tilapia
XP_007228290 235 dhhQNHHSLLQTMCQsLPLQMCTKLSQKQKKIRLMYWEVLKQW------------------ASSMEYdvsggV-W---VQ 292 Mexican tetra
NP_001038699 220 ---KESDGGLNTFCSvISPEVCAVISRQSPEFRKLYWGALKQW------------------ASCLEYdviesV-W---VT 274 zebrafish
XP_006011742 222 ---LGNGGQLQAFCTcVHCILLTEIASRHPRFRAAYLQVLTEW------------------GESMEYmpsggRgW---MS 277 coelacanth
XP_012823448 230 ---LENDSAWTDFCSkINCHLLSRLSSKYVIVSKAYMDFLIKV------------------GESMELdv-hgK-W---VS 283 tropical clawed...
XP_030129162 245 ---LGNQERFSAFCLcLPSSQLAFLAGHYSQLSRSYLDLLTSW------------------GSRLVYdplqgR-W---VK 299 zebra finch
XP_001636561 342 NemTQGGLdnlerakTFEALVEHFRALTDGPDYVKRRCRNAIQDVQRealLSCGSNKLGASIWADLEKAL 411 starlet sea anemone
XP_005809971 291 Aa-TNSAV-------SFQKMTEHYLTLFEACPSLRTEVEDELNAQRI---ADGDFDVRGLSVWGDILLAL 349 southern platyfish
XP_004070011 282 Eg-TAPSL-------SFQEMVEHFSDLFDACPSLRRNAEDELLALKI---LDGDFDARGLSVWGDILSEL 340 Japanese medaka
4_pfamImport 269 Tr-RNPTV-------SFDRLTEHFLGLFETCPSVRVDVEEELNALKM---SDGDFDVRGLSVWGDLLS-- 325
XP_005450884 283 Ts-TGPTV-------SFKKLTELFLALFEASPSLKGGVEKELNALKI---SDGDFDVTGLSVWGDLLSAL 341 Nile tilapia
XP_007228290 293 QcdTFP---------SFKTLVNHLKSIWRSGSPLKEETEKELVVLKQ---VDGDFEVQGLSVWTDLLLQL 350 Mexican tetra
NP_001038699 275 S---EGAG-------SFDVLADRLRDLINSGESLKEETETALKALTL---QDGDFSVKGVSVWTDLTLQL 331 zebrafish
XP_006011742 278 S---LPGL-------DWGKLLKHFSSLIKGPKAVQEATESTLQTLKA---QDGDFNEWGISVWTDLLLAL 334 coelacanth
XP_012823448 284 S---NAEL-------PFNTFRNHFESLMNTSEDLRSATEAKLKALKS---QDGDYDLPGISIWTDILLEV 340 tropical clawed frog
XP_030129162 300 SclDKAEL-------SWEELRERFICLCQGPALLREQTQAALELLRT---RDGDFKVRGLSVWTDLLMEv 359 zebra finch
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap