Conserved Protein Domain Family
Chlorosome_CsmC

?
pfam11098: Chlorosome_CsmC 
Chlorosome envelope protein C
Chlorosomes are light-harvesting antennae found in green bacteria. CsmC is one of the proteins that exists in the chlorosome envelope. CsmC has been shown to exist as a homomultimer with CsmD in the chlorosome envelope. CsmC is thought to be important in chlorosome elongation and shape.
Statistics
?
PSSM-Id: 371373
View PSSM: pfam11098
Aligned: 5 rows
Threshold Bit Score: 174.676
Threshold Setting Gi: 193087487
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q3AU27            11 MSESYQKLRKDFKELEFTDRLTFLAESVLLTGQGAVVGGLNFAGSLVDTVTGTVGSVIEATGISkllGNTSGVVGETIDR 90  Chlorobium ...
jgi:Ctha_0291      1 MTEAYDKLRTQFKELPLTDRIAFIAEATVMTGQSALSDSMGLFGGVFENIGSSVDSIIKATGLS---NSSNNVVSQTVER 77  Chloroherpe...
jgi:Cpha266_2300   1 MSESYQKLRKDFKELDFTDRLTFLAESVLMTGQGAVVGGLELAGSVVETVAGTVGSLIDATGIGamlGRTGGVVGETIDR 80  Chlorobium ...
jgi:Paes_1961      1 MSESYQKLRKDFKDLELTDRVAFLAEGALLTGQSAVVGTLEIAGSVVETVAGTVGSLVDATGVGrllGNTGGVVGETLDR 80  Prosthecoch...
jgi:Cphamn1_2196   1 MSESYQKIRQDFKDLELTDRMTFLAEGALLTGQSAVVGGLELAGSLVETLSGTVGSLVDATGIGrllGSTSGVVGDTIDR 80  Chlorobium ...
Q3AU27            91 VAITVKDASRAAGELYVNAVETVENATSNAATAVGDAGVSASEVVKNFAGSFQKVTI 147 Chlorobium chlorochromatii CaD3
jgi:Ctha_0291     78 VAITVKDAGKAAGTIYKDVAKGVDDATGGIAKGLGDVTSQASEVVKNVTGTIQKTAA 134 Chloroherpeton thalassium ATCC 35110
jgi:Cpha266_2300  81 VAITVKDVSRSAGELYSDAVKNVDNVTDNAARAIGDAGVSASEAVRNIAGSFQKTTV 137 Chlorobium phaeobacteroides DSM 266
jgi:Paes_1961     81 VAITVKDVSRSAGDLYSDAVKNVENVTDNAAKAIGDAGVSASEAVKGVASTFQKSVG 137 Prosthecochloris aestuarii DSM 271
jgi:Cphamn1_2196  81 VAITVKDVSRTAGELYSDAVKNVENVTENAATAVGDVGMSASETVKGVQGSFQQSGG 137 Chlorobium phaeobacteroides BS1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap