Conserved Protein Domain Family
SyrA

?
pfam11089: SyrA 
Exopolysaccharide production repressor
SyrA is a small protein located in the cytoplasmic membrane that lacks an apparent DNA binding domain. SyrA mediates the transcriptional up-regulation of exo genes involved in the biosynthesis of the symbiotic exopolysaccharide succinoglycan. It does this through a mechanism which requires a two component system.
Statistics
?
PSSM-Id: 491608
Aligned: 3 rows
Threshold Bit Score: 39.729
Created: 15-Feb-2025
Updated: 28-Apr-2025
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_012654210 18 AVATYFLSGSLAGTLIKTVLAAVLLQVGYFCAVAYLVF 55  Rhizobium/Agrobacterium group
O87908       18 SLAIYFALQPCPGFIVTTLACLLLFQLAYFGSVLLLVC 55  Sinorhizobium meliloti 1021
Q7CTZ5        9 AVATYFIHGSFYTAFIQTLICAVILQVGYFIGILVLVS 46  Agrobacterium fabrum str. C58
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap