Conserved Protein Domain Family
PRD1_DD

?
pfam11087: PRD1_DD 
PRD1 phage membrane DNA delivery
This small family of phage proteins are bound in the viral membrane and assist, along with P11 and P18 in the delivery of DNA.
Statistics
?
PSSM-Id: 151532
View PSSM: pfam11087
Aligned: 2 rows
Threshold Bit Score: 50.2911
Threshold Setting Gi: 94730671
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q3T4M7  1 MGEFGKTLITIVTAIIGVAIIAVIVSQRSNTAGVIQSATSGFSNILKSALAPII 54  Enterobacteria phage PRD1
P27390  1 MNDFVGPIVTVLTAIIGVAILAVLVSRNSNTAGVIKAGSGGFSSMLGTALSPVT 54  Enterobacteria phage PRD1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap