Conserved Protein Domain Family
DUF2870

?
pfam11069: DUF2870 
Protein of unknown function (DUF2870)
This is a eukaryotic family of proteins with unknown function.
Statistics
?
PSSM-Id: 402586
View PSSM: pfam11069
Aligned: 33 rows
Threshold Bit Score: 111.204
Threshold Setting Gi: 296005237
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_006681816 195 ASIWWANKELQREKKLCDYIGK-NDKTKIIVKLQKRGQGPPLREAPISEQQQKEMMAY-YYRKQEEQKKLAENDEDEYLN 272 Batrachochytriu...
4_pfamImport   1 VELWWAGKQFTRGKDVCDVVGK-NDKSTLIVTLQKQGDGVPRRQSVVRAEERDAVTALcSQEKQKRQQQVVKDDAEDYYK 79 
EED91061     261 ASLWTCNKEFIRGKLVSDRLGScNEKTKIVAKLTTKGSGPPAREPIVSEAERNAMTAF-YFKRQEELKKLSQADEDDYLN 339 Thalassiosira p...
XP_002905321 183 TELWWAGKQFFRDQHVCDLTGK-NEKSTLIVKLQKKGGGAPSREPGVSEEERKAMMAF-YFKKQQELQQAAEDDAEDYMK 260 Phytophthora in...
EAY04406     143 VQFWVTRKSYQRGKHIFDYTGK-NERQTFVAKFTGPESGPPPRDMTMDKEAQIRLMSQ-MHRKAEELKRIENDDDTSYLD 220 Trichomonas vag...
CAM72960     165 AVMWWSAKPLARDSDFVKYIGK-NDKTKITVKLAAEGSAAPPREPAVDAKAQAELMQH-FYRKQEEMKKLVEDEDISFGN 242 Leishmania infa...
XP_001568991 203 AALWFCGKPM--EATLAKYCGR-NEKSKVIVKVAPRKGPAPSCEPRMRYEDQRALYHA-MCQRRETYKQL---DDSELRD 275 Leishmania braz...
Q383T3       180 AGLWFCGKLM--EDTIARYSGK-NEKSRLTVKVHPKDSVPPSTEPRISYDDQRALYER-MRTRREEYKGL---EESELRD 252 Trypanosoma brucei
XP_002509113 183 AQLWWAGKQMLPGNKLSVHVGR-NEKTKVVAKLTKKGAGAPQRENPITPEEHKAMLAY-YHKRQEEMKHLEQNDEDDYTN 260 Micromonas commoda
XP_001749553 188 FQLWWAGKELQRGKKLSDFIGR-NEKTKIICKAQKKGAGQPTREPVYDEETQKKMMAY-AYKKQEEWKQLEKADEDAYLN 265 Monosiga brevic...
XP_006681816 273 -SSWADTKALKSAFNGMQ 289 Batrachochytrium dendrobatidis JAM81
4_pfamImport  80 iSPWADPSMLKNSLRGTD 97 
EED91061     340 -SEWADPKGMKRNLQGLN 356 Thalassiosira pseudonana CCMP1335
XP_002905321 261 -SSWADPKALKNALRGTG 277 Phytophthora infestans T30-4
EAY04406     221 -SQWANPRGLKNTFQGLE 237 Trichomonas vaginalis G3
CAM72960     243 -SAWANPHGLKNQLQGLD 259 Leishmania infantum JPCM5
XP_001568991 276 -RVVRQSRGAERLLLG-A 291 Leishmania braziliensis MHOM/BR/75/M2904
Q383T3       253 -RVVAQARGKVALTAPAA 269 Trypanosoma brucei
XP_002509113 261 -SAWANSRALKNHFSGv- 276 Micromonas commoda
XP_001749553 266 -AEWASSNQLKSQLHGTS 282 Monosiga brevicollis MX1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap