Conserved Protein Domain Family
DUF2865

?
pfam11064: DUF2865 
Protein of unknown function (DUF2865)
This bacterial family of proteins has no known function.
Statistics
?
PSSM-Id: 402581
View PSSM: pfam11064
Aligned: 27 rows
Threshold Bit Score: 107.455
Threshold Setting Gi: 168195221
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
vbi:Avi_1888         189 GYRTLCVRTCDGGFFPISPSTPARDFGR-DAETCNRLCpGTEAELYYSRL-TDEAKDMVSTVTGqPYRDMPHAFAYLSRV 266 Agrobac...
jgi:Rvan_1672        239 TYRTLCVRECDGFYYPISTATSESQFPA-DAERCQSQC-ASPAELYYHRS-DQDVDQMVSLSGR-LYVTQPFAFRNRKVF 314 Rhodomi...
Q2K7N9               189 pVSTICVRSCDGGFFPISSNTTSVDFGR-DAQTCAKMCpGIETELFYRDVtSTDASNMISAATGaPYSAMKNAFAYKNRA 267 Rhizobi...
goetting:OCA5_c05720  74 RSASYCVRTCDGKYFPLPART-----SMpPAQMCQSFCpASTTKIYF----GSNIETALGANGE-RYSELQNAFAYRKTL 143 Oligotr...
Q20WV5                84 SGPAFCVRSCDGRYFPLTTRG-----GAtAAQMCQAFCpASPTRVYF----GSNIDGATASNGE-RYADSDNAFAYRKAL 153 Rhodops...
Q6N0N7                85 GGPAFCVRSCDGKYFPLQIRA-----GAsPAQMCQAFCpAGNAKVYY----GSQIDGARAANGE-RYADSPNAFAYRKVL 154 Rhodops...
EGP09763              85 RFTTYCVRTCDGRYFPLTGRG-----SGtPAQMCQAFCpASQTKVFS----GNSIDYAVGHMGE-RYVDTPNAFAYRKAL 154 Bradyrh...
Q89UE8                73 GGAAYCVRGCDGRYFPAQGND-----AEsKAQSCKSFCpTSETSLVY----GSNIDDATTEGGK-SYSDLPNAFRYRNEI 142 Bradyrh...
Q6N231                76 GGQAYCVRTCDGRYFPISSSG-----SDtKAETCNSFCpASDTKVVY----GSSIESARTSGGK-SYSELPNAFKFRTEI 145 Rhodops...
Q20Z86                86 GGQAFCVRTCDGRYFPVNGAD-----NRsRAETCNSFCpASETKVMY----GSTIDNALAA-GK-SYSELPNAFKYRSEI 154 Rhodops...
vbi:Avi_1888         267 pgqPGQCSCNRSNSdGLQTNAPKPGLgTDSGGSSVI 302 Agrobacterium vitis S4
jgi:Rvan_1672        315 ---VKGCSCKATEY-SREEIAKFEETqRTSKRADAS 346 Rhodomicrobium vannielii ATCC 17100
Q2K7N9               268 pgeKNSCACNLTA---YYEEMRGKQAlSEPPQQGSI 300 Rhizobium etli CFN 42
goetting:OCA5_c05720 144 ---KADCTCNGRSP-GGLAPVDLALD-TTLRPGDIV 174 Oligotropha carboxidovorans OM5
Q20WV5               154 ---KADCTCNGRDP-AGLAPVDLTLD-TSLRSGDVI 184 Rhodopseudomonas palustris BisB18
Q6N0N7               155 ---KEDCTCNGRDP-AGLAQIDLSQD-NSLRAGDIV 185 Rhodopseudomonas palustris
EGP09763             155 ---KADCTCNGRDP-AGLAPVDLSLD-ATLRPGDIV 185 Bradyrhizobiaceae bacterium SG-6C
Q89UE8               143 ---VSGCTCNGKDP-VGLAQIKIEDD-PTLRKGDIV 173 Bradyrhizobium japonicum
Q6N231               146 ---VAGCTCNGKDQ-FGLAKIPIEDD-PTVRKGDII 176 Rhodopseudomonas palustris
Q20Z86               155 ---VTGCTCNGKDQ-FGLAKVDIDDD-PTLRKGDIV 185 Rhodopseudomonas palustris BisB18
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap