Conserved Protein Domain Family
DUF2863

?
pfam11062: DUF2863 
Protein of unknown function (DUF2863)
This bacterial family of proteins have no known function.
Statistics
?
PSSM-Id: 402580
View PSSM: pfam11062
Aligned: 22 rows
Threshold Bit Score: 526.463
Threshold Setting Gi: 644863605
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
nioo:CFU_1739     13 PSKKPSRKSSADSHRLAELAQALIQASSRLEERAWEREIEALLNKHFKARHQEPIDGALEQLFPVEPDAYDALMDVVEAC 92  Collimonas ...
WP_015435654       4 TRQKRRGGLGRDAEQLIWLATGLAQSGSRAEDQYWEQQLVSAIDRLLAEGEEETLNNALDHLYSADTRGYDELADFVESR 83  Azoarcus sp...
CAL94786           7 TRLKRRGGLGRAAENLAWLATGLSQSGSRAEDQFWERELTGLIDVQLQQHDEEVLNAALDHLFSGDTGGYDELADFIESR 86  Azoarcus sp...
ACR01259           4 TRLKRRGGLGRTAEQLVWLAGGLAQSGSRIEDHYWEMQLARLIDETLTENDEEVLNAALDHLYSADARAYDELADNIESR 83  Thauera sp....
WP_014237375       4 PRFGSRSRVSRDVSQLSWLATGLAESGGKLEDAFWEARLAALVEQLLADGNEEELTAALDRLYEANAQAHDELADMVESR 83  Azospira or...
jgi:CAP2UW1_2162   4 NRLSSRKRISADATELGRLAIGLAESGSKLEDTFWQARLAELLDRLFHDGAEDDLTAALDRLFDTHPMGHDDLADIIESH 83  Candidatus ...
Q47C07             4 TRFGSRDRLSRDAAELQRLAAGLSESGGKLEDAYWEAQLAETVDGLLKNGAEDDINTALDRLFEANPRGHDELADMVESR 83  Dechloromon...
Q2KXA3             4 TRSTTASRLPRDATRLISLAQALHRSGSRVEDLYWEALLAEAIGKLLRPGSDGPLEAALDHLAQQDIGAYEVLIEQAETL 83  Bordetella ...
Q7VX14             4 TRSQSSPRLNRDASRLVALAHALDRSGSKVEDLYWEAQLAEAITKLLRSGHDAPLESALDNLAQTDPGAYEVLIEQSETL 83  Bordetella ...
CDM25086           2 pprsRSSSLSRTSQTLISLAEALSRSGSHLEDVYWEGRLGEALDKALGARHGRAVESALDVLLEQRSAAYEILVELAEAR 81  Castellanie...
nioo:CFU_1739     93 SESSTIDYQGQQYDCLLVGIPLLAWTRFSIGSGPIPSDVMLTLGAHLHAHILAPEVMTAMVPSLYAIDQLPRSHSETYAL 172 Collimonas ...
WP_015435654      84 AESA--GAAGPEHDVLLIAAPVLAWSRYRIPANTIPAAVLSNLGVHLQAHVLGGKVKLALADFLFSPDQLPQGYCATANF 161 Azoarcus sp...
CAL94786          87 AESA--SRLSDKHDVLLIAAPILAWSRYRIPTVALPAAVLANLRVHLQAHVLAGNARLALADFLFSPDQLPQGYCATAEF 164 Azoarcus sp...
ACR01259          84 AECA--AGSLAEHDVVLIAAPVLAWSRYRIPAANIPPAVLANLRVHLQAHVLAKGAKLSVADFLFSPDQLPQGYCATAEF 161 Thauera sp....
WP_014237375      84 AESCLVSHQGQDYDVLLVAAPVLAWSRFGIPTANIPAGTLAALKAQLCGHVLAAEARVAVVDFLFSPDQLPRSYSDTYRL 163 Azospira or...
jgi:CAP2UW1_2162  84 AESCILLDQGQEFDLLLFAVPVLAWSRFSIPAAAIPRNLLQTIKVHLGAHVLAAGARLALADYLYSPDQLPHSFVDTWQL 163 Candidatus ...
Q47C07            84 AETNRLEALGQAFDIQLFAAPVLAWSRFSIPACPLPKSTLQALAVQLGAHVFGGDARLAIADFLFSPDQLPRSFCDTWQL 163 Dechloromon...
Q2KXA3            84 SESMKVEKNGLRYDVLLLVAPIVAWTRYAIPTGPIPAAAQEALLAQLHGHILAADARVALLPHLVSIDQMPRTFAETAQW 163 Bordetella ...
Q7VX14            84 SESMQIEKNGTRHDVVLLVAPVVAWTRYTIPTGPIPAPAQQALLAQLHGHILADGVRVALMPHLVSIDQMPRTFAETWQW 163 Bordetella ...
CDM25086          82 SESLMPGPDGQDCDTLLISAPVLAWSRYRLPPGRLDAAQSQALETLLAETVLGPEARVALLPSLVRFDRLPQSFQETRGW 161 Castellanie...
nioo:CFU_1739    173 LQQLSHAALTAAPVRSP-ADQPQTAPFLADTRYLLAALVAPSGMPLFRWQmmhgqpghIaaDKEQALEQWRNQVTPNMTR 251 Collimonas ...
WP_015435654     162 AAELARAAIAGRNLKIDtADMPETAQFLSDTRYVLGAIVVPRGEALFGWQep-------drNRDDALNQWRMQGGACLAP 234 Azoarcus sp...
CAL94786         165 AAQLGAAALENHDLHIEtEGMPETAQFLSDTRYLLAAVAVPRGEPIFRWQer-------dsSRDQALTQWRLQGGACLAP 237 Azoarcus sp...
ACR01259         162 AKVICGAAADNLDLHIDtDGMPETAQFLSDTRYLLAAVAVPRGAALFRWQep-------dgTRDGALEQWRAQGGACLTP 234 Thauera sp....
WP_014237375     164 TNELGRCALAGQDMALDtREMPETNRFLSDTRYLLAAIAVPRHSPLFYWHev-------egNREVARQQWRQQGGAALEP 236 Azospira or...
jgi:CAP2UW1_2162 164 MRRLGAAALTGDDLNVDaSAMPETNRFLSDTRYLLGALTVPRGKPLFRWNead------ktTREGALKEWLKQGAPCLEP 237 Candidatus ...
Q47C07           164 TRELGEAALAGKHLAVDtAGMAETNRFLSDVRYIVGAIAVPRGKPLFRWNea-------dgNREASLKEWIKQGSPNLEP 236 Dechloromon...
Q2KXA3           164 MQRLANQALGAAPARPIiNAEAETANMLADTRYLVAAVAVPEQSALFRWQesp-----edaNRDACLARWSEQALPTLAG 238 Bordetella ...
Q7VX14           164 LHRLGTQALGAETAKPAlNDDVETANMLADTRYVVAAVAVPERAPVFRWQerwd---dpqaSRDACLAQWVEQAQPTLAA 240 Bordetella ...
CDM25086         162 TQALAQRALGLRRDGPAlRDAEAPEDLLADVFFLVGAVVVPRGGAVFQWQspl--paeAp-DQEAVTRRWAEGCARILEP 238 Castellanie...
nioo:CFU_1739    252 LLPGCGIQLLLPEAYFAACREADLQIRPASLRAASYYLSHTLD-IASKDLHASIGRFSEQpesgRVDEYRIGFSLG-QTN 329 Collimonas ...
WP_015435654     235 LLPGCAMEVVLPDAYFAASRLADNHSRPYSIRASVAFLGAELE-TPASNLRAVIAPFHDR----ELQEYRVGLTLR-GNE 308 Azoarcus sp...
CAL94786         238 LLPGCAVDVVLPEAYFAASRAADTASRPYSVRASVAFLGTALD-TPATNLRAVIAPFWES----QLEEYRIGFTLR-ERE 311 Azoarcus sp...
ACR01259         235 LLPGCAVDLVLPDSYFAASRAADKDSRPYSVRASVAFLATTLE-TPAANLRAVVAPFWER----TLEEYRIGFTVR-GRD 308 Thauera sp....
WP_014237375     237 LLTGCAYEALLPDAYHAACRQADKDSRPYSLRASVAFLQTVMG-VEPASLRVAIGPFHDQ----RLEEYRLGFSLQsQAD 311 Azospira or...
jgi:CAP2UW1_2162 238 LLTGCAYQALLADAYHAACRAADSASRPYSLNASVDFLRTALGeAVSDNLRAVVGAFHDK----RLEEYRIGFGPA-DSD 312 Candidatus ...
Q47C07           237 LLTGCAWQPLLADSYHAACRNADRLSRPYSLKASVAFLQTMLG-LMPADIRAVVGPSYDR----RMEEYRIGLGPT-TGD 310 Dechloromon...
Q2KXA3           239 LLPGCGLECLLPDAYYVSNREADRRVRPLSLRAALSWLEGAIN-MPASQLRAVIAACGES----HTEEYRIGFTPR-HSN 312 Bordetella ...
Q7VX14           241 LLPGCGIECLLPDAYYVSNREADRRVRPLSLRAAIAWLESAVS-LEPSQMRAVVAGCGEA----RIDEYRIGFTAR-NSN 314 Bordetella ...
CDM25086         239 VFTGCQLEYLRPEAYYTSTRQADQGIRPLTLKAAATWLQTAAR-IPGTDLRAALVACGEQ----SVEEYRIGFCTR-QSN 312 Castellanie...
nioo:CFU_1739    330 EVIYGVVWPLYGpEEANEEivsragdSEAATAEPETPLEQILSLLRECGIDDIQRHAELFAMEFCDDCGTPLYPDREGDL 409 Collimonas ...
WP_015435654     309 QVVHGVVWPLLGaDDQSAE-----------------GTAEIEAVLRDCGVTDIVNLEHRFPLEYCDDCGAPLYPSPEGEI 371 Azoarcus sp...
CAL94786         312 DVIHGVVWPLLGaEDDQTD-----------------VISQIDAVLRECGVTDIRVLDHRFPLEYCDDCGAPLYPAPDGEV 374 Azoarcus sp...
ACR01259         309 EVVHGVVWPLLGaEDETTD-----------------CVAQIETVLRESGLTDVVALEHHFPLEYCDDCGAPLYPSPEGEV 371 Thauera sp....
WP_014237375     312 KVIHGVVWALIGtEDENSE-----------------SVAEMETVLRECGVTDIVVHDHRFPFEFCDDCGAPLYPNGEGEL 374 Azospira or...
jgi:CAP2UW1_2162 313 VVYHGVVWPLLGiEDETTD-----------------VAGEIESVLRKAGIREVVVLDQQFPYEFCDDCGAPLYPSVEGDT 375 Candidatus ...
Q47C07           311 EIYHGIVWPLLGaEDEATD-----------------AAGEIEAVLREAGVKDVLFLDHHFPMEFCDDCGAPLFPNREAEL 373 Dechloromon...
Q2KXA3           313 DVYYGCVWPIYG-REE--E-------QTADE--DNAAESVIAALLKELGVAEVRRIPGRLQVEFCEDCGAPYFPDPLGVL 380 Bordetella ...
Q7VX14           315 DVYYGCVWPLYG-RED--D-------VPADEGQPNAVDE-IAALLKEYGVSDVRRIPGVLPPEYCEDCGAPHFPNPLGEL 383 Bordetella ...
CDM25086         313 DVIYGCVWPALS-REESQP-------EPDAEGQVDTWDT-IAALLRECGIQDIRRLPGLQPMEFCEDCGTPYFPNMLGDM 383 Castellanie...
nioo:CFU_1739    410 VHPEMPDDTPAGSAHF 425 Collimonas fungivorans Ter331
WP_015435654     372 VHAEMPEEHGEQPPRh 387 Azoarcus sp. KH32C
CAL94786         375 AHAEMPEEHAEQMPRH 390 Azoarcus sp. BH72
ACR01259         372 VHAEMPEEQGVQAPRH 387 Thauera sp. MZ1T
WP_014237375     375 MHTEIPEEQAEQPPRl 390 Azospira oryzae
jgi:CAP2UW1_2162 376 VHAEMPEQDDAPSQtl 391 Candidatus Accumulibacter phosphatis clade IIA str. UW-1
Q47C07           374 VHAEMPEQPAANSQVl 389 Dechloromonas aromatica RCB
Q2KXA3           381 VHAELPENAEAAPAQF 396 Bordetella avium 197N
Q7VX14           384 VHAELPEDAEAVPAKF 399 Bordetella pertussis
CDM25086         384 QHPELPEEIDPEPVQf 399 Castellaniella defragrans 65Phen
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap