Conserved Protein Domain Family
DUF2861

?
pfam11060: DUF2861 
Protein of unknown function (DUF2861)
This bacterial family of proteins has no known function.
Statistics
?
PSSM-Id: 402578
View PSSM: pfam11060
Aligned: 13 rows
Threshold Bit Score: 230.787
Threshold Setting Gi: 81398362
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q7ME76               23 WFEQNTPLTQAHQHLLEDNLPGMFESLVEVWQSSPTDTLKEHLNSLLIQSLNR-DCGKSL-TKKTLPN-WLTGVKVIRQT 99  Vibrio v...
WP_012600630         23 WFKDSDALTQVHKHLLDNDLALMFDSLVEVWQINASQSREDHLNQLFDQALNK-DCGKTL-TKKTLPD-WISSVVVKRHI 99  Vibrio
Q87HP5               22 WFQTNTPLTQAHQHLLEDDLAGMFNSLVELWQTEPSKDLTPHLNDLLGQSLSK-NCGKSL-TGVTLPD-WISGVNVIRQT 98  Vibrio p...
Q9KM22               28 WFEKNTPLTQAHQHLLNNDLESMFSSLVEVWQLEKNKNLKTHLNNLLIQSLSV-DCGRGL-DNKPFPD-WIQGVTIRRVD 104 Vibrio c...
JLExeter:vfu_B00206  23 WFENNTPLTQAHQHLLNNDLESMFASLVEVWQLEHNKNIKSHLNDLLVQSLTV-DCGKGL-DSKPFPE-WIKSVLIRRID 99  Vibrio f...
WP_022561442         23 WFEQQTSLTSAHQKLLEDDLEGTFDAIVEVWQQNPSKYVSDHLDQLFLKSIEK-DCGRSL-NSEGLPD-WLDEVVIRRQM 99  Vibrio n...
Q5E014               27 WFNEQSALYTAHKQFLEGHARKGFATSIEVLQNSANENITNNIDKLLSSAISV-NCGRDL-SNKVIPN-WLKSVSVQRVI 103 Aliivibr...
Q6LIV2               28 WFNGQDLYTTSHQRILEGNTSAGFDSIIQAWQQAPNTEQQANLNELLEFAITE-DCGHSL-EQKALPS-WLSKLSIQREV 104 Photobac...
Q7NY92               19 pllpaTPLEPAYHALLSGDRAGAWRQLDALGAAMSSAAQRQAWLTLQRELASG-QCGR---DAPAAPPaWLGD--LELDL 92  Chromoba...
Q9KMR5               36 WFRT-TPLQSSYQLLVEGHPTQAWHEL--IHTLSTTPVAEPFWQPIKEAILSQtQCGQAL------PSaSLNDLAIAVTF 106 Vibrio c...
CCO59974             20 WFAN-TPLQDTYQALIEGHPEWAWQEL--HLALGNQALESQYWLPVKQEILNQtRCGLDLsERPVLEP-------IKIHF 89  Vibrio n...
WP_012600723         21 WFTD-TPLQHTYQSLLDDQPQVAWQEL--QIALDQAELNSQLWLPVKQEILSRtQCGSTL-EQSATPN-----NHIQVSF 91  Vibrio t...
Q6LJF3               22 WFAD-TPLQSSYSALSANQTLLAWQEL--QLSLSQNQISEHYWQPIKDTVLSKtQCGKQLiSLVNLPA------NIDVSF 92  Photobac...
Q7ME76              100 IQSPGRDTYRLVIDIRSNVEVKSLA-----VRKW-VDRSV-SSDSVFTe-iSGDGVTNGGDEKQYQKRyNLTGKLDSGLY 171 Vibrio v...
WP_012600630        100 IQSPGRETFRVAIDVESESNIQDIT-----FEKW-VDKVV-SSDSEFT---KGNPVINNTSVSVYSKRySLASQLDSGLY 169 Vibrio
Q87HP5               99 IQSPGRDTFRLVIKLRATTDIEDIS-----FRRW-VDESI-SGDSSFSyeeQADG-TEIANERSFLKRyNLTGKLEAGLY 170 Vibrio p...
Q9KM22              105 VQSPGRDAYQVAIDTKTKVPITDIR-----LTKW-VDKVV-STDSSLTn--RSDSVT--TNIYTYAQRyNLTNPLSAGLY 173 Vibrio c...
JLExeter:vfu_B00206 100 IQSPGRDAYQVLIDTKAKKAIADIR-----LTQW-VDKPL-SNDSTFTr-tDRDNVT--SQNISYLKRyNLNTKLNMGLY 169 Vibrio f...
WP_022561442        100 IQSPGRNNSSVIIDVLSNKDVESIE-----LDRW-GEQNI-SNESTFEk-lSSET----SEQSIYQKRySLNTRLTSGLY 167 Vibrio n...
Q5E014              104 IQSPGRLHHRLIVKFDTKKPISSLS-----FIKWpQEEQL-TNPSIKTtptQDERIT----QYTYASE-SLNNRIQNGLY 172 Aliivibr...
Q6LIV2              105 IQNLNQVMLKLSIVGLTRTKISEIT-----FTKWpEDNIIvSTPSIQE-----------GGYFSVEAR-RMEKPLSSGIY 167 Photobac...
Q7NY92               93 IQRDIPLSRVYNVRLNGVSPRRDLR-----WSLRlPDGREl---------fAGAKTRYDGRQFELESE-DQAAALPPGVY 157 Chromoba...
Q9KMR5              107 IHKFNQTFQGYQVRLSAENLSQPLA-----VRLAsSQGATl---------lAAEL--APADYAEVESR-DLLSPYAAGVY 169 Vibrio c...
CCO59974             90 IRRLGQTSAGFQIKVSAEQVKTNIP-----FSVIsPNGKRl---------iEGKLLTKEG-YQERESQ-EMLITPPSGIY 153 Vibrio n...
WP_012600723         92 IKRHGLSSQGYQIKVSAEQLSEGLEdqtqrISLVsPDGKVv---------iDGQV-NSDVEYQEIETS-EMFIKPESGVY 160 Vibrio t...
Q6LJF3               93 INKNSVNNQGYQIKISTEQVTQPLI-----LKLFnENNTLl---------vTANIPQPTEEYIEFESN-DLLSTPKAGIY 157 Photobac...
Q7ME76              172 QLVVQPAGQE--VWSGWVILGEPIAPQYVRWSSKENWTVEKVALNNP-----YCPLPEMNVGLYDYVDGQYQRVWNKTY- 243 Vibrio v...
WP_012600630        170 RLTVKGNSGN--SWSTWVILGEVVMRQQVRWASKDSWLIDKKALLNP-----YCPLPKLDVGLYDYVDERYKQVWGKSY- 241 Vibrio
Q87HP5              171 HLSVVSKDKQ--VYRTWVILGDSNSSQYVRWTSKENWKVEKSALRNP-----HCPLPQLEVGLYDYVDGQYEQMWKKTY- 242 Vibrio p...
Q9KM22              174 RIDITAADQE--SWSAWVIFGDTIAKQVVRWTSKDEWQIQKTELLNS-----HCPLPKLSISVFDHIDGNYKQIWSESY- 245 Vibrio c...
JLExeter:vfu_B00206 170 RLDITANDQE--SWSAWVIFGEPKAKQTVRWASKDQWVVEKNALLNR-----FCPLPKLGVSVFDYVDGKYKEIWNQSY- 241 Vibrio f...
WP_022561442        168 LLKIKPANEE--AWVTWAIMAEPQAKQVVRWQSKDNWKVEKTSLLNK-----HCPLPVLNISLFDYLDGKYQKVWTQDY- 239 Vibrio n...
Q5E014              173 KLIIIADDKEktQWESWVVLTTPKTEMQVAWLGKDKWKTTQTGLLKS-----NCPLPEMAVGIYDHQDNEYIKLWEQTY- 246 Aliivibr...
Q6LIV2              168 KITVKADDEK--DWISWVVLSEPVLKQSLGWRDSKNWRIEQEGLPNP-----ACPSRILSINLYDLNDTTWTPLWTEEI- 239 Photobac...
Q7NY92              158 RLTAQSGGE---TWRQDLSLPGMAAQD---WLRRDG----RKLAPRPptqpsACPRPWLEQALLSQPD--FELRWWQ--- 222 Chromoba...
Q9KMR5              170 WLTLG-------EQRMALLISAPSSTP---WIEQSS---AADLTIRFpatpsGCASSLAR---WQFFDQNFTLLHSQTVn 233 Vibrio c...
CCO59974            154 QLELG-------SVSYPLIISLSNDNP---WLALSK-NAKPKLVLTMpetpnNCVNAFAS---WQWFDSQYQQLGRIIPi 219 Vibrio n...
WP_012600723        161 QLTIG-------SNNYPIIVALDDNKR---WLTLESKLNDPHIVVTPpeiidSCPDANVS---WQWFDENYDMLGFKVPv 227 Vibrio t...
Q6LJF3              158 QLSIN-------NVRYPLVVSSFTNTT---WVQQSTDQTSKSFIVTPpankiACAPVVMN---WQWFDEQYNQLGRHIPm 224 Photobac...
Q7ME76              244 -----------------ESDYPNSLELEGIPNERYVLAVSMNTKRWQGEILVEQSQTISRTYD 289 Vibrio vulnificus YJ016
WP_012600630        242 -----------------ESDYPTNLTGEELPNDRYVLAVSMVHSRWQGDIAIEQAQTISKTYD 287 Vibrio
Q87HP5              243 -----------------ESNYPNSLELAGVPNDRYVLAVSINSRRWQGDIIVEQAQTISRTYD 288 Vibrio parahaemolyticus
Q9KM22              246 -----------------ESDYPTTLDNVSLPSDRYIVTVSMIHQRWQGPLAIEQSQVISKTYD 291 Vibrio cholerae
JLExeter:vfu_B00206 242 -----------------ESDYPTSLELNNLPSDRYVLAVSMTHQRWQGPITIEQSQVISKTYD 287 Vibrio furnissii NCTC 11218
WP_022561442        240 -----------------ESDYPNSIPLRDLDPDRYVLAVSITHRRWQGAVSIEDQQVISKTYD 285 Vibrio nigripulchritudo
Q5E014              247 -----------------EEKFPKSLPSTNVLPGSYILSVSFNHKRFQGPISIQEIQAITKVMN 292 Aliivibrio fischeri ES114
Q6LIV2              240 -----------------DGKLPTTLPKIDVPSGRYWLSVGLIKSRWQGEISILDIQRITRPVD 285 Photobacterium profundum
Q7NY92              223 -----------------RRELGQTLRWPANPGEKLWASVSLLRAEFRGPIAVRQIHRVAAPLs 268 Chromobacterium violaceum
Q9KMR5              234 -----------------RDQHPAP---PIAPSQARWRSLSVIQSEYQGTIRVEQMQRLTIPID 276 Vibrio cholerae
CCO59974            220 g--------------dkTADIPRP---HHESNGAEYLSASVKVREYQNGIAIDYVHRMSIPYt 265 Vibrio nigripulchritudo
WP_012600723        228 k--------------ttQASLPTE---SPIGSEAKHLSASVEMFEYQGAIEIQYVQRVAMPf- 272 Vibrio tasmaniensis
Q6LJF3              225 qltpvmpvtsaptdrnlQYEAKRP---ATTPSNATWLSAVVSQFEYQGELKVEYVQRFSLPIS 284 Photobacterium profundum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap