Conserved Protein Domain Family
DUF2612

?
pfam11041: DUF2612 
Protein of unknown function (DUF2612)
This is a phage protein family expressed from a range of Proteobacteria species. The function is not known.
Statistics
?
PSSM-Id: 402570
View PSSM: pfam11041
Aligned: 21 rows
Threshold Bit Score: 174.764
Threshold Setting Gi: 163259030
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q32CZ0               4 VAATVLAQYAASPRLNALINSFNAALSPDSFISDFYGLIWN---IDTAEKYGLDVWGKIVGVSRRLTVKDDFNYLGFSES 80  Shigella ...
ACR28721             7 YTSLITSEHQPRPKFMALVGALVSPLVDQMNVVASMPALFD---LDNAVGDQLDKVGEWVGLSRQVSTPLIGVYFSFDVA 83  Burkholde...
jgi:Xaut_3652       11 YVGLITSEHRGKARFTATVRATVQPAADTQAFLDDLPGAFD---LDSAIGVQLDAVGAWVGISRLISIPLITVWFSWGIV 87  Xanthobac...
CCD02865           100 YLGLITSEHASQPLYRAALTALLKPLSDGQGSFAGLADRFD---LDRAVGDQLDTIGLWVGASRRLTVPLTGVYFSFDTA 176 Azospiril...
CAP41329            11 aWDHWLSQFDGKPRLQALVKALLKPA---EGLQGALRDLYDkrwLDAAEGKQLDGIGEIVGLSRVLDNAVFVAFFGFVGQ 87  Bordetell...
REF_pohc:D11S_2212   3 YADLLIWQYRNKPKAVATIKLMESIIAQGFVDLYQLQDVLN---IETAKGHQLDLVGKHVGQGRIINGYQMRKFFGFRGS 79  Aggregati...
Q2NRI8               5 pEAALIWQYRGKPRARQTVGLLFSESRELWTSVLTLASLLD---IDKATGYGLDLIGRHVELGRTLNAFIPKAYFGWLGA 81  Sodalis g...
Q7N347               5 pEDFLIWQYRGKPKARQTVGLLLSESAIVFKSAVKLTEILD---INKSENYGLDLIGRHVGISRTMKSFVPKDYFGFLGI 81  Photorhab...
Q2NTV3               4 YTDFVTPQHWAAPKFVRHIQLMTRPLQDIAALAGQLNALFS---LEGAFGKQLDAIGEWIGLSRYVKTPITGVYFALDTD 80  Sodalis g...
AHG21261             4 YQQLITAYHADKPKYLDTIGLSSAPFTAIQSTLGDFINKFD---LDRAVDSQLDALGLWIGIGRVVRSTINGIYFSFDTT 80  Chania mu...
Q32CZ0              81 RmdtpvmddpRPF-----NQAPFYNGKSVTRTA--DLTDAIYRRLILMKAMSNITDCSVPDINRMLRFMFGK-KRRAYVL 152 Shigella ...
ACR28721            84 D---------LGF-----DQGTWKGPFDPDTGLv-SLDDDTYRMTLRAKIAANHWDGTPDKAADILDLLAPP-GTNVFIE 147 Burkholde...
jgi:Xaut_3652       88 G---------RGW-----GEGIWKGPYDPETGIy-ALDDDTYRKLIRLKILVNNWDGLTGSAASAFEDFYASdGSYPFIL 152 Xanthobac...
CCD02865           177 G---------VGF-----DQGSWWAVGDPTGYLt-VLPDDGYRTLIRARIAANAWDGTIPGAYAVWDIAFAGtGYSVLIQ 241 Azospiril...
CAP41329            88 Ps-------vEGF-----SRARIRRRYERTVAGstTLPDYEYRKLLYWKIAVNNGYGTTPEIIAAIKPIFD--VTRVVVQ 153 Bordetell...
REF_pohc:D11S_2212  80 Tq-------aLGFsksrsGGGQWYRRRDPLADSv-RLSDEDYRFLIKCRILKNYQTGTLPNMIEACRFIF---GDGCRVI 148 Aggregati...
Q2NRI8              82 Da-------aQGF-----GDGVFYLLGEALNDSt-RLEDDDYRFLLRARVLKNTLRPTMAAISAAIRYLL---GPQVVVI 145 Sodalis g...
Q7N347              82 Ds-------aLGF-----NTGVFYRYGDSLNDSt-NLDDKDYQFFIKAKVIKNYQRPTIGNITLSISYLL---GDQAFII 145 Photorhab...
Q2NTV3              81 R---------VGF-----DQGSWKRRFDADSGFt-ELDDETYRAILRAKIRANHWDGTCEMLAAIYQGVIPDrTVNIFFT 145 Sodalis g...
AHG21261            81 G---------LGY-----DQGSWQGVFD-DMGFt-ALDDEAYRTILRAKILANNWDGTMATLSNIYQSVFPDdKTQIFAV 144 Chania mu...
Q32CZ0             153 NNGGLRMS-YVFESALSSAELAIIQSSGALPSPPGVYVSV 191 Shigella dysenteriae Sd197
ACR28721           148 DPCDMSITiGVSGKQPTAIYIALLKTGLLSLKPETVHINY 187 Burkholderia glumae BGR1
jgi:Xaut_3652      153 DNEDMSMTaCISGARPPAIMFAIFAGRYVEFKPASVRILN 192 Xanthobacter autotrophicus Py2
CCD02865           242 DNQNMTMDfALLGPSPDAVTLALFTGGYLNVRPAGVAVNA 281 Azospirillum brasilense Sp245
CAP41329           154 DAGNAKVRiWMNRIPSTA-EALLNDPHRWIPVAAGVGIKV 192 Bordetella petrii
REF_pohc:D11S_2212 149 DNYDMTVSvSVSNQNISDFKKFAINNLDILPRQAGVQYIF 188 Aggregatibacter phage S1249
Q2NRI8             146 DNHDMSMNiVVPEKMLTPLRLYAVHHLDILVRPVGVRYQL 185 Sodalis glossinidius str. 'morsitans'
Q7N347             146 DNYDMTMNiVIPSSYLTPFRLHAIKKLDILSRPIGVQYKY 185 Photorhabdus laumondii subsp. laumondii
Q2NTV3             146 DNQDMSMDvYLTGGVVPEVIKAVIRQGYLNIKPEGVKLNa 185 Sodalis glossinidius str. 'morsitans'
AHG21261           145 DNLDMTMSvYLSGAPLPAVLQSIIAFGYLDVKPGGVRIAd 184 Chania multitudinisentens RB-25
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap