Conserved Protein Domain Family
Grg1

?
pfam11034: Grg1 
Glucose-repressible protein Grg1
This fungal protein increases during glucose deprivation. Its function is unknown.
Statistics
?
PSSM-Id: 402568
View PSSM: pfam11034
Aligned: 47 rows
Threshold Bit Score: 50.7955
Threshold Setting Gi: 634352152
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
EGX54119     20 SLKNAGNYVAETVQGKTAEASKEANKEQAKgNVagKDSLTDRASGAFGAASDKLDQTKHDASARANKE 87  Arthrobotrys oligospora ATCC...
Q5B324        3 TIKNTVNYVTESIQGAGATASKEVNKDVAK-DN--NADLTTRATAAKDALFDKKDEKVHETQADVYKE 67  Aspergillus nidulans
XP_007818372  3 SVKQAANYVSETVQGAVSGASHEANKEVAK-DS--NANVGTRLSAAKDAVGDKIDQNTHDGKAEVHKQ 67  Metarhizium robertsii ARSEF 23
EGX90883      3 TAKQAVNYVSETVQGAVSGASKETNKQVAK-DS--NASVGTRLGAAKDAVGDKLDESGHNAKADAHKE 67  Cordyceps militaris CM01
EHK23889      3 TAKQAFNYVAESVQGATSGVSKETNKEIAK-ND--NVDVSTRLTAGKDALGDKIDETVHNNKAEAHKQ 67  Trichoderma virens Gv29-8
EGU84616      3 SLKQAGNYVAETVQQATSGASKEANKEVAK-DG--NVPISTRATAAKDALGDKIDETTHDKKADVHKE 67  Fusarium oxysporum Fo5176
XP_006670801  3 SIKQGANYVSEQVQKATSGTSKEANKEVAK-DS--NANVGTRLSAAKDAVGDKVNESGHDAKAEAHKQ 67  Cordyceps militaris CM01
XP_007825188  3 SLKQGANYVSEQAKKATTGTSKEVNKDIAK-DS--DAPLGERASAAKDAVSDKASEQKHGAKAEVHKQ 67  Metarhizium robertsii ARSEF 23
Q4WW28        3 SIKQGVNYVSESVQQAVHGTSKEANKQVAK-DS--DAPIGTRASAAKDALTDKAHESKHDAKAEAHKQ 67  Aspergillus fumigatus
XP_006961516  3 SIKQGANYVGEKVQQATSGASKEANKNVAK-DS--DAPLGTRASAAKDALGDKVDESKHDTKGEAHKQ 67  Trichoderma reesei QM6a
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap