4MQD


Conserved Protein Domain Family
ComJ

?
pfam11033: ComJ 
Click on image for an interactive view with Cn3D
Competence protein J (ComJ)
ComJ is a competence specific protein.
Statistics
?
PSSM-Id: 402567
View PSSM: pfam11033
Aligned: 6 rows
Threshold Bit Score: 171.1
Threshold Setting Gi: 323436312
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4MQD_D          12 ELSISYHQFTVFQKDSTPPVXDWTDEAIEKGYAAADGAISFEAQ--RNTKAFILFRLNSSETVNS-YEKKVTVPFHVT-E 87  Bacillus subt...
jgi:Weevi_0048   7 DLEISHHQIHLRSGDFNPKNEQWSKEDIIQGAILTASHVTFDPIvdGDFAAMVTVSFQHEFTASKdALRIIKFPFTVV-G 85  Weeksella vir...
Q819H6           2 ELTISYSQLMLMNYDGEQPYVDWTDEDFERGYAKADGTVIFEAL--SDYTCEVKVTPGKHIEKEE-VVRTITVPFTVE-N 77  Bacillus cere...
ABV61007         9 SLSISYHQITVYTGSKTPPVIDWSDDDILQGFAMGDQGVSFEGI--NNGKASVTVTLNNDISPAS-ADRTITIPFTHA-S 84  Bacillus pumi...
Q62Z16           9 EMTMSYHQFTVYQKGGKPPVMDWTDEDIKRGYTTGEHAVSFEAL--ENTASSVEVRLNAQKQVPS-FNRRVTVPFEVL-Y 84  Bacillus lich...
WP_014372299    12 ELLISYAQLAVYASGLSNPFPEWTDRHLRQGFAWRPGSVSFAAL--EDVHSEIMVSLGGKPAPDRdAVRAISVPFTVTgG 89  Paenibacillus...
4MQD_D          88 NGIHIESIXSKRLSFDLPKGDYQLTCWTVPa---eXSDLHADTYIIDAV 133 Bacillus subtilis subsp. subtilis str. 168
jgi:Weevi_0048  86 DLVLSSVPAEHTLLVSPEEGTYTGYFEICE-----SEEVSEVYYQFTFV 129 Weeksella virosa DSM 16922
Q819H6          78 ESIVITSILSNKFQIPIPNGEYTVVLQAIPleeptDDELYKIQYEFFFE 126 Bacillus cereus ATCC 14579
ABV61007        85 DQVYITSVMAQVLSFPIPKGDYQLTCYTTQq---pDEDL----YHIHFQ 126 Bacillus pumilus SAFR-032
Q62Z16          85 DGVEIASVLSKKLTCDIPQGAYQLTCYTIMp---dHSGTAQITYLLDFK 130 Bacillus licheniformis DSM 13 = ATCC 14580
WP_014372299    90 GGITVSSILSRSYSYDLPHGSYELLFQAVPlp-apEPKAPKVRYLLHFT 137 Paenibacillus mucilaginosus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap