5Y9X


Conserved Protein Domain Family
Kdo_hydroxy

?
pfam11004: Kdo_hydroxy 
Click on image for an interactive view with Cn3D
3-deoxy-D-manno-oct-2-ulosonic acid (Kdo) hydroxylase
This is a family of 3-deoxy-D-manno-oct-2-ulosonic acid 3-hydroxylases, which catalyze the conversion of 3-deoxy-D-manno-oct-2-ulosonic acid (Kdo) to D-glycero-D-talo-oct-2-ulosonic acid (Ko). It contains a potential iron-binding motif, HXDX(n)H (n>40). Hydroxylation activity is iron-dependent.
Statistics
?
PSSM-Id: 402546
View PSSM: pfam11004
Aligned: 19 rows
Threshold Bit Score: 357.364
Threshold Setting Gi: 122310650
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5Y9X_A            26 TQEIQDKAIEGLESGSVLFFPKLNFPLLTEELKFLD---------PTWVSGAk---NISYDPRSATL--------KG--- 82  Methylacidi...
Q2YBZ7            29 APELQRAAIDMLEGGGVIYLPKSGFELSCHERELISdtanilsrtPDVEDGRp---TIIFDPERGRIkkyhyaqvRGk-m 104 Nitrosospir...
CAS:CtCNB1_3212   15 qVQGRDEWTAAVEAGKVLYFPQLSFQLTEQEKALLR---------PDVRDPKt--rNISLNVD-GSI--------KG--- 71  Comamonas t...
Q7NX88             8 vkEGDKGLVSRLEAGAVLHVPDFGFTLSAAEQALLN---------PAIADPKr--kNISLEPNNGAL--------HG--- 65  Chromobacte...
Q0WGC8            24 NAEDNTGAIEALEQGKVLFLPHLTFELSEQEKQLLD---------PTLVDVKr--kNISFKPLEGVL--------TG--- 81  Yersinia pe...
unil:wcw_1297     17 pETIKERSIQKLENGSILLYPHLKFGLEEQEKEFLT---------PEVLKPGt--kNISYQIQTDSL--------SG--- 74  Waddlia cho...
CBJ11611          11 eqiNHQESISRLEEGTVLFFPRYFY--TSIDPDLFS---------ENILDGSr--kNISYDIRTKRL---------G--- 65  Legionella ...
Q83CY7            17 TKEIQSEIIEQLEKGKVIYFPKLTFPINLDQGVFLD---------PNYLAKGq--kNISYDPKTQSF--------KG--- 74  Coxiella bu...
jgi:Acid345_2070  22 aADRSRDWCSELESGKILLFDGVPFDLPSEDRDFLL---------SQKQAASrfhkNISYRPEKNIL--------RG--- 81  Candidatus ...
WP_015897158      18 TPEQARDWCAQLESGDILYFPQTPIALSPDDIAFLR---------GQQQTDSslhkNIAYKPSLDKL--------SGfda 80  Acidobacter...
5Y9X_A            83 VEGKSED--LRLLSGLLKRYAEKTAAFLHLLFPFYGSSLKIARTSFR--PVEisgratsaRKDDTRLHVDAFPSSPTGGE 158 Methylacidi...
Q2YBZ7           105 MRAQVKNtaRPQIEAMMSRYSKWTESVITQLFPSYQGALERKRVTYR--PFP--------RNNIQSLHIDSSYGYPTQGR 174 Nitrosospir...
CAS:CtCNB1_3212   72 VAGDEAT--QAQVAGMVGRFREQATALIAGLFPAYMPVVRMAPTSYR--PSQvetraqswRADDKRMHVDAFPSRPNYGE 147 Comamonas t...
Q7NX88            66 VLGGDDA--QRAVRALISRYQHAAADLLARVLPEYQGKTRAAPTSLR--LVRvedrktswRKDDSRLHVDAFPSRPTYGE 141 Chromobacte...
Q0WGC8            82 VTDASK---IALTRQLLDRYYQSCLSLVQQLLPVYTHALHSPTNSLRlhPVAawrdstswRKDDSRLHVDAFPSRPNYGE 158 Yersinia pe...
unil:wcw_1297     75 LQLSGEA--GERLRQMIKRYAETSRKLIQKVFPTYIDHIEMGRTSYR--PVEaegrqtssRKDDTLLHVDAFPSSPVRGS 150 Waddlia cho...
CBJ11611          66 AYKKEVNglNDKLLSMMHGYAEFAHQLIQSVLPSYVPHLQWGRTSFR--PAQvegrvsskRKDDTRLHVDSFSASPVHGL 143 Legionella ...
Q83CY7            75 LNPQKQN--VAPLKEIIKDFSTRATQLITTLFPYYHSKFRIGRTSFR--PAEiagrktsyRKDDTRLHVDAFPSTPMQGE 150 Coxiella bu...
jgi:Acid345_2070  82 IANDSPD--RERMQQVMGRYSREVVNFVMRFLAPYARDFKLDYASFR--PLEeksrdlvlHKRNDLLHVDAFPTRPTRGA 157 Candidatus ...
WP_015897158      81 KTANAEA--VARLQSVMRGYSQSVVRFLTGFLSPYAAQWKLDYASFR--PQEeqnrdlplRRRNDRLHTDAFPTRPTHGA 156 Acidobacter...
5Y9X_A           159 RILRVFSNINPQgKPRSWRIGEPFQNYLNHLLPQLSPPa-pGKRFLLYLFG-------------------ITKGYRSLYD 218 Methylacidi...
Q2YBZ7           175 GMLRVFSNINPTdRLRIWQLGEPFEPFVRRFLPAAHPSepsWITSILGRLG-------------------IIDGPKTRYD 235 Nitrosospir...
CAS:CtCNB1_3212  148 RILRVFTNVNPDgQPRVWRVGEPFTDVAKRFVPRAKPYs-aWQAKALELLH-------------------VTKSYRSEYD 207 Comamonas t...
Q7NX88           142 RILRVFCNINPAgEPRVWRVGEPFEDMARKMLPRVPVQw-pGSAALLAALK-------------------ITKRKRSGYD 201 Chromobacte...
Q0WGC8           159 RIIRIFTNINPHgEARSWRVGEDFTQLASRYLPQLDSYs-sLSSWLQHKIG-------------------ITKRPRSHYD 218 Yersinia pe...
unil:wcw_1297    151 RILRVFANINPSqIPRVWKVGEPFEDVIRQMAPRVKKPf-tPIFPLMKWVG-------------------ITKSLRSPYD 210 Waddlia cho...
CBJ11611         144 RILRVFCNVNPDnEPRIWNLGEPFTDVLHRFGPKIASYs-kIKAKVLKFVK-------------------ATKTLRSPYD 203 Legionella ...
Q83CY7           151 RILRLFCNINPYnQPRQWHLGESFGQVIKQFAPAVSPPl-pLAHTLLNLLG-------------------ITKRKRSLYD 210 Coxiella bu...
jgi:Acid345_2070 158 RILRVFTNINPI-VDRVWTTGEPFHVMAPGLARPAGLPh-fANPSLAQRFVfatqra--------ghvigLPFPNRSRYD 227 Candidatus ...
WP_015897158     157 RILRFFNNIHPD-RTRDWVVGDPFAQTVRQFAP----------AQIAPRPGtlvsrsgkalgralglskaLPGLKRTPYD 225 Acidobacter...
5Y9X_A           219 HYMLELHDKGKLDLEYQKNSPQVAFDFPAGSTWIVFTDQVLHAVDKGQFLLEQTFHLKVNALKHPEKSPLKLLETALNK 297 Methylacidip...
Q2YBZ7           236 RYIATLRSLGMRDKEYQRTAPRKIMEFPAGASWIAITDLVLHGAISGQHSLDQTFYLPVEAMKDSSRSSLRILERLAGK 314 Nitrosospira...
CAS:CtCNB1_3212  208 HLMLQLHDGMKGDPDYQKNAPQETVPFAAGSTWVCFSDQAVHAVMSGQYMLEQTLFLPPGSEYNPAASPLSILSRMKGH 286 Comamonas th...
Q7NX88           202 HIMLHLHDAMKADLEYQKNCPQETVPFAPGGAWICFSDHASHAVMSGQFMLEQTLWLPLEKMDDPAKSPLRQLERLTGR 280 Chromobacter...
Q0WGC8           219 HLMLQLHDKMKADLAYQKDGLQQAIEFPPGSSWICFSDQTPHAAMGGQFMLEQTLLLPVEGMKSSQRSPLKILEALTQK 297 Yersinia pestis
unil:wcw_1297    211 HYMLNIHDSMKKDQSYQNTCPQQVVQLPAGSTWMVYTDQVPHAVLSGQFVLEQTFYLPVEGMQNQQTSPLRQLESLLNQ 289 Waddlia chon...
CBJ11611         204 HYMLHLHDTMKLDDSYQANVNKIQIDFPAQSTWIVFTDHVSHAALSGQYLLEQTFYLPVDNMDNPDFSPLNQWKRIrpe 282 Legionella l...
Q83CY7           211 HYMLKIHNTMKGDEEYQKKAIQEKIAFPANTTWVVFTDLVSHAALSGQHLLEQTFYIPPTAQFFPQYSPLKKLETLLGH 289 Coxiella bur...
jgi:Acid345_2070 228 RFMLHFHDWLKENSNFQQNSPKVRTDFSPGCSWLVYTDGVPHAVLSGQYVLEQTFIIPQRALVAPERSPLQVLETIANT 306 Candidatus K...
WP_015897158     226 DFMMRFHNFLKENETYQQQTARYPWQFPAGSSWMVYTDTVPHAVLAGQYALEQTFLVQPEALVRPEVSPLRVLEDIAGA 304 Acidobacteri...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap