Conserved Protein Domain Family
CBP_GIL

?
pfam10995: CBP_GIL 
GGDEF I-site like or GIL domain
The GIL domain, for GGDEF I-site like domain, is a c-di-GMP binding domain on the BcsE proteins of enterobacteria. It is not essentail for cellulose synthesis but is critical for maximal cellulose production. Cellulose production in enterobacteria is controlled by a two-tiered c-di-GMP-dependent system involving BcsE and the PilZ domain containing glycosyltransferase BcsA.
Statistics
?
PSSM-Id: 402537
View PSSM: pfam10995
Aligned: 30 rows
Threshold Bit Score: 407.03
Threshold Setting Gi: 519072432
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
PRJNA312505:AYM40_06005  17 AWPVGQLAIDALPGEWATLEAGKLYAVYAa---aRTPGADALLWESARQAQArDVTVVLARaRAQVARRLRElg--fSaN 91  Burk...
WP_020228307             25 TARPAGLGVDGLPHGVGRLPAGAPAALLV-----QDEACWQDWPPALVADLLaAGPVLALAaQAGDLDALLR-----MpA 94  Acid...
WP_007850257             36 GATPTRIGIEGLPDGVGLVPPHVPVSLVAa----DDSSAALWFPALIEDAVV-AGPVALVAsSAAWTDGLLQ-----RpA 105 uncl...
jgi:Rmet_2253            20 LQARTLLAIEGLAPALGTLASGRAHVVYAq----PSPARDAFFWQTAAVALRgPASVLSTRdADGIAKVLREhgldiDvN 95  Cupr...
WP_038713874             34 VSTLSRLAIDGLPDEWTQLESGGLYAIYAa---aRTPGCDALVWESTRQARTrDVTIVLARnEATVAAQLHErgfagTaI 110 Burk...
Q7NUM5                    1 MDSPIDLDIANLPPAITSMAPSCLYLVVC--------DSDALIHGLLFVNLPgANATPAVFcCDQTPGRQHD-----TrW 67  Chro...
EGI77353                  1 METGKVYAIVGEDDA----PSAALLWQTLldaseKGAAATLISAPGMAEHLA-QSGLQTKAhEALRRKSLAV-----FeT 70  Hyle...
goetting:EBL_c01450       1 MGPVFSLGIRPLWAELSHMPAGGIWWINTd----RKQDALSLLNATLAEQAP-DARCAAVV-MDKTDLEQIT-----L-A 68  Shim...
WP_072015290              1 MKPIFTLGIQSLWDELSHMPSGGVWWVNAd----REEDAISLVNHTLAAQHK-KSRTALIT-MGSDPNKIIN-----L-E 68  Pseu...
jgi:Fraau_2358            8 SHEPVCLPLLGLQTEITAMHSTGLYWIHAd----SRATAMRLGLALIAAQSA-AAQMLLID-NDALGRKIVE-------H 74  Frat...
PRJNA312505:AYM40_06005  92 APASGWPRNLSVLAMPPaggasagsaGTgvH----GVPPVALa-RVFGGLrALkrfgfRSRSLYFVEGAERwfNWEDPAA 166 Burk...
WP_020228307             95 LAQAHAAGRLRTWLLPP---------EAqaQlrrdGLGALAQ--ELARNGlGP-----HTSLCVLDAHAML--AGATVAE 156 Acid...
WP_007850257            106 LQAAYRAGRLQLWLLAP---------GLqaEvrrhGLAPLVE--ELERTGlQP------GHALYVCDAQGLl-SGLSVTE 167 uncl...
jgi:Rmet_2253            96 RALHSRANLCALRAQPG---------RDgiD----ALIDALQalTDQCGA--------RGTMFLIEGAEAFf-SWQDAVS 153 Cupr...
WP_038713874            111 AP--GWPRNLNVLAMPVrgi----alDPpgGgghaSRGPFTR---LLGGLrALrhfgfRTRSLYFVEGAERwfSWDDSSA 181 Burk...
Q7NUM5                   68 LDRRMLSGSLTLLSPKGs-------aRP-------ALTECLE--ELSHAR-DPlrrgdENELLVLGNAEKYl-GFDHPDA 129 Chro...
EGI77353                 71 VP--PARSATPPTPAAN---------LAhaH----GLVQDLT--YLERKT-GR-----RAQLLVINGMDTLf-PALDEAT 126 Hyle...
goetting:EBL_c01450      69 AN--SGPGKVSLFTMPG---------QI--K----ALQAFSS--DLIRNI-NP-----EHFFIILLLSEKIf-ENVNNSE 122 Shim...
WP_072015290             69 AD--HGPDKIHLFSMPN---------HK--D----GLSFFTR--DLLSAI-DP-----QHYFMVLLCANNAw-QNISADH 122 Pseu...
jgi:Fraau_2358           75 LPAASGPARLDLWQLDA---------GKtsT----IARWLVR--DLDRIL-QQ-----RPDLIVLSLNMTGp-HVSDPAE 132 Frat...
PRJNA312505:AYM40_06005 167 LAREGRMLANWCAVRNITLVLllGSPSDadadfa--------adspfVePAFNSaaaqhGRNEFHAACAGVARMeh-tHG 237 Burk...
WP_020228307            157 LQRLAGQWRRWSAARRRPVAL--LLPLHraq-------------aegG-NDLGAa---vRAQAAFRHVAELGTL----SG 213 Acid...
WP_007850257            168 LARVSRQLSALCRERLRPVVLg-FFPPLep-------------------evLLP-----ALRNLCQMSMHIATLra-eAD 221 uncl...
jgi:Rmet_2253           154 LASQGVRLNDWCAKERCGVLL--VVAP----------------------PPLAPgqsppDLQAFHGRFAGAAQLsq-qQG 208 Cupr...
WP_038713874            182 LAEEGRALADWCRTHRIGVVL--LMDPEavrrdgassdtetddvpivR-GAHRA-----KRGGFHSVCAGVAQLqr-tHG 252 Burk...
Q7NUM5                  130 ASRELRAATQWAEEKRRCVLL--LANRq------------------rL-DMAAQa----ILAKAASLCAGLALAqkigAG 184 Chro...
EGI77353                127 LRFWRTCAEQ--EDRAVVLLF--REHAr------------------aL-SALRP-----MV----HVVAGLAELks-rYG 173 Hyle...
goetting:EBL_c01450     123 LVSWLTITSRWTNAHHASLLV--LNPGn------------------sL-GKQTA-----RLMGEYPRLSGLADLhy-qSD 175 Shim...
WP_072015290            123 LRGWLEKIHGWTKYHDCTLLI--VNPGn------------------nN-DKQYS-----FLMSEYRSLFGLASLrt-qAD 175 Pseu...
jgi:Fraau_2358          133 LATSLASLAGWLQARGCLMLV--ISHGQ-------------------A-AGLET-----RLFQMGHRVHGFAMLad-rGN 184 Frat...
PRJNA312505:AYM40_06005 238 ELLWHVDFWRSGRTLVTGDVRSLRFTd-DGRLSv--------aSDAL-----GNGdargdGMLARDEQRVVVSRAVVRGh 303 Burk...
WP_020228307            214 RPVLTLYRWDGGQGAVFDARYDLRRD--GGRLC----------YDGSfslgaQPV-----LADAPDQFAVHATRASVAG- 275 Acid...
WP_007850257            222 RWSLGLERWNTDAGALFQTAFGLLHD--GARDRl--------aADGT-----RTRgavreLVEAVDQSEVIATRASVDG- 285 uncl...
jgi:Rmet_2253           209 QYTWEVAFWRDKQSVVAGEVLRLRFAphEQRLMvasdtysdqiEEAG--------------MLAPDEDRVIVSRDAVLR- 273 Cupr...
WP_038713874            253 ELLWVVDFWRVGDSLTAGEVRPLRFAp-SGRLSa--------iFDADaa--vQPRg----MKLASDEDRVVVSRAVVER- 316 Burk...
Q7NUM5                  185 VYSWQTEHWMGAGAAAEAQTHVLGHDv-SGALRl--------lREEP-----DALa----ARPALDLFLVHATRASLDG- 245 Chro...
EGI77353                174 ATTLGIFHWFHREGLLASRSVAVRQG--SRGALe--------vCEPPrg--tQASnalttPPPAADEAQFIAMGSVFAP- 240 Hyle...
goetting:EBL_c01450     176 QHRYSVQWWCSDKGIAGRSQVPVTHT--ENGWEv--------lTSTD-----TPP------QSYTDDQRILCQTDVLEG- 233 Shim...
WP_072015290            176 IHLYDVAFWFNEKGVSARQQLIVEQN--NGSWKi--------aQQEQ-----ASV------QPRSDEKRILSNVMVLEG- 233 Pseu...
jgi:Fraau_2358          185 IYLYKLSYWCNRSGVFSQLEYALDWQsaETRFTl--------aCGQP-----PQL-----PSSSTDQDQVLAMSPVMEG- 245 Frat...
PRJNA312505:AYM40_06005 304 EAWVPSNWEVLADQKAVLAA-CVDAQAATVVLDYAGGAQLDALCAAIHALRRQAGRALKIVVAERGE-VLRHQYELLVLT 381 Burk...
WP_020228307            276 QRGVPAAWQIADSLAALEEA-GRGAAGATVLIDAGVPEQFAAVAALVHRLRQTRPRSLKIIVRETEA-KLRAHSEQALLR 353 Acid...
WP_007850257            286 QRGVPGHWRIVDSLADLEVA-AAASVAATVLIDAGQASDFEARARLVHQLRLSRPLTLKIVVRENLG-KLRTHSEQALLQ 363 uncl...
jgi:Rmet_2253           274 ERFVPENWRIVDSNEAAVAT-ASQSVAATVILHYSGSRDLELLASQVHRLRRSAGRALKIVIREDRE-AMRQHYELLMLN 351 Cupr...
WP_038713874            317 EEWVPNDWEIVADNAAVVAA-CAKAHAATAVLVFRSRAKLEALCAAVHTLRRQCGGALKIVVVERGE-VLRHQFETLVLS 394 Burk...
Q7NUM5                  246 NTPPPPQWQLYDDLPALTAA-AGGAVAATVLLD-TGTSQRETLADAVSGLRRQCGSRLKILVRESGNrRLRRNEEQLLLQ 323 Chro...
EGI77353                241 QEKAPSGWRITDDDLALVQAlGEDAVAATFVLAFTPETDFDPLARCIYGLRKRGGPRVKILVREVGT-RLRYNQETLAVR 319 Hyle...
goetting:EBL_c01450     234 APAFSEHWVLFSTSNALFEA-ARSASAATVIFSLSQVGQVERVARAVHSLRLQRGSALKLVIREKNP-CLRATDERLLLG 311 Shim...
WP_072015290            234 APPLSEHWTLFDNNEALFSE-ARTTQAATIIFSLMQNNQIEGLARHIHTLRRQRGSTLKIIVRENNA-SLRATDERLLLG 311 Pseu...
jgi:Fraau_2358          246 EPAPSSNWHLFEAFDALADQ-AMRAYSATLLLSVQQTDDIIPLARWLFQLRLSRGSHIKVVVREMAT-CLRYADEHLLLS 323 Frat...
PRJNA312505:AYM40_06005 382 LGANLVLGRDLPFSRMQSLLQSLQGQLHTRPIAADYRTSLSAALSEDVLGYLPAGTFCERVRAVLERSA-VLQLPHVLVK 460 Burk...
WP_020228307            354 LGVTSVVYREVGFARLQKLIEDGRHLVYAGAIGSDCAQTLAACMPAAARGYQRPARFVQLAGDMLARTE-AAGLSHCLVR 432 Acid...
WP_007850257            364 LGASAVVYKEVGFSRLLQLLQDINAQSHTRKVHPDYEQALDSFMPARERGYQPPAQFCTLVRGMLDRTH-GIGLSHSLVR 442 uncl...
jgi:Rmet_2253           352 LGANAVVAQRTPFARMQAMIDALQGQVFSRPILADYHSALSAVLTTSATGYVTPDTFLSLVRDAVDRSRl-IRLPHVLLQ 430 Cupr...
WP_038713874            395 LGANSVVGRDLPFSRLQTVMRSLYGQLHARQVATDYRAALAAALGDSVLGYLPVGAFCLRIRAVMDRGL-VLALPHTLVK 473 Burk...
Q7NUM5                  324 LGANLVLPAELRFASAVSLIHALQPAVYQRRNHLEPQILRNASLPPTDRGYLPPARFAEMVRKTVQRSG-AIQISSTLVI 402 Chro...
EGI77353                320 LGANLVVPAELSTARFLSLSTMVQGQVFPHSLPSSYEQALKTSMPEQERGYQPPAEFTRTVRAALAQSQvLG-VQVALVR 398 Hyle...
goetting:EBL_c01450     312 CGANMVIPWTITLSRSLAMIDAIKSQVFHQHVPRDFDQLINSVRPLSLKGLQPWETFCRAINDLLNNPLiAFDSKGVLVA 391 Shim...
WP_072015290            312 CGANMVIPWNAPLSRCLTLIESVQGQQFNRPVPEDISALLTMTQPLKLRGYQTWDTFCDAVSNMLSNTLlPTDGRGVLVA 391 Pseu...
jgi:Fraau_2358          324 AGTNLIIPFGASFGRVQTMIESVQGQLWPASPYRQVEELLEQYQPPSAAGLVSEAGFMLQLQKLRLGSP-SQRLNHVLLR 402 Frat...
PRJNA312505:AYM40_06005 461 LTLRPQCAHVEALRSCVPRRAGDVFTADASHLYVFLFACRLADGDAALARIFNVPVERIAGD-----IVHLAEQSIGNEL 535 Burk...
WP_020228307            433 LQLLPTVAHLDALRACRVQRDGDLVTADAQGLYVFLFACRESDLDLALSHLFTLPLGALFSSq----AQDATAGGMALML 508 Acid...
WP_007850257            443 LNVLAQIPHLDALRACHTARDGDLLTADHESVYVFLFACREPDVELALHRLFTLPLTQLFSSe----ATDSSDTGIRAML 518 uncl...
jgi:Rmet_2253           431 LPLLPEVAHIDALRACHMNRAGDLCTAGSDSVYAFFFACRLDDVDAVCARVFQRPMADMFQGd----LRSGDNESIAATL 506 Cupr...
WP_038713874            474 MPLLPDVAHVDALQHCMPRRAGDVVTADAENLYVFLFACDPADADEALKHIFDVPVERL-SDr----IVCLGNGSVDAEL 548 Burk...
Q7NUM5                  403 LSPAGGIRPWEMLAPDRFRRTGDLCTADTLQAYLFLFACGEADVPAALRNQFRLPVTDLADSa----TRCPDNASILQAL 478 Chro...
EGI77353                399 LPLAYGLQPLDALRYCTIKRAGDLCGADAASVYLFLYACRENDVDATLKRLFTLPVGELFTGd----DRLLSPRAIEDAL 474 Hyle...
goetting:EBL_c01450     392 MRPVAGLRAEQALTLCRPNRTGDIMTIGHGQIFLFLSFCLINDLDKALSRIFPFPVADIIANr----TVWYEDKNIAAQL 467 Shim...
WP_072015290            392 LRPVPGIRVEQALTLCRPNRVGDIMTIGDNRLMLFLSFCRINDLDTALNHIFPLPIPDIFSNr----VVWFEDNQIAAEL 467 Pseu...
jgi:Fraau_2358          403 LQPKAGIDLETAIRQFTVKRRGDMICTSGDQAYLFLYACRANGIERALQNLFRLSWHDLFDRpesldLTYFLEHGFSSAP 482 Frat...
PRJNA312505:AYM40_06005 536 NAlaaasrrtpiadysdlfatpfrnqtappataarAGTVLPAGDGMSTAGQLAAveqaleaarAeaeRAlgpeagheagq 615 Burk...
WP_020228307            509 ERlrga--------------------------aahLPDYGPLLEPIAAPAPREAqpaagagggAallPVv---------- 552 Acid...
WP_007850257            519 APlhesvrkglpdysatl--agsprpatapapaqtAPAVTPALPAAPGLAPEAA---------G---TEsrpl------- 577 uncl...
jgi:Rmet_2253           507 SEleadiqay------------------pppdytrWLAQEPSSHTEPSDAPTEA---------CpttPApvqt------- 552 Cupr...
WP_038713874            549 EAlkaqnrrapiad---------ysdlfakadpdaGGGGAAAATDAPVGADAGA---------A---PDagasagaaagt 607 Burk...
Q7NUM5                  479 TR---------------------------------LENQPNPSPPRPRDGARAA-------------------------- 499 Chro...
EGI77353                475 RDydsrgasgrfpeltgelarlasapglaasspstVSSAPQESAAQPTPAASRA---------R---NTs---------- 532 Hyle...
goetting:EBL_c01450     468 VE---------------------------------MGKSSLGQLNQPLPQTSGS---------Q---DA----------- 491 Shim...
WP_072015290            468 VQ---------------------------------MRALVPEKWGKPLPVIDGP---------N---PI----------- 491 Pseu...
jgi:Fraau_2358          483 EG---------------------------------RMPGHPGRKATNLPLTAST-------------------------- 503 Frat...
PRJNA312505:AYM40_06005 616 a----------easgpiaprplqPLQPPPapaprTAPPQRRAEPYAM 652 Burkholderia sp. OLGA172
WP_020228307            553 -----------------------VAVLEEaphrgAAAVQVSARPIGR 576 Acidovorax sp. MR-S7
WP_007850257            578 -------------------lplaDGPGVQ-----HRPIARRAVPRPS 600 unclassified Acidovorax
jgi:Rmet_2253           553 -------------------lpliAPRRAQggggpRALPRHHPVPLKP 580 Cupriavidus metallidurans CH34
WP_038713874            608 gtgtgtgagagagvaaaagsdahEAPQAP-----DAQPADTPPLAVR 649 Burkholderia sp. lig30
Q7NUM5                  500 -----------------------SAKGPA-----RVALRRLPLRRRD 518 Chromobacterium violaceum
EGI77353                533 ----------------------aSLSAAY-----VAPPPAVPAPLTL 552 Hylemonella gracilis ATCC 19624
goetting:EBL_c01450     492 -----------------------MNIHYN-----EQGWRREPQPVTL 510 Shimwellia blattae DSM 4481 = NBRC 10...
WP_072015290            492 -----------------------LNAEHN-----GQSWRRIPQPHRL 510 Pseudescherichia vulneris
jgi:Fraau_2358          504 ---------------------------AD-----NRPLPLRPRPMTT 518 Frateuria aurantia DSM 6220
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap