Conserved Protein Domain Family
CsiV

?
pfam10972: CsiV 
Peptidoglycan-binding protein, CsiV
CsiV, a small periplasmic protein (cell-shape integrity in Vibrio), is essential for growth of Vibrio cholerae in the presence of DAA, non-canonical amino-acids, the typical components of peptidoglycan side-chains in Vibrio cholerae. CsiV interacts with LpoA, the lipoprotein activator of penicillin-binding-protein1A that is necessary for mediating the assembly of peptidoglycan. CsiV acts through LpoA to promote peptidoglycan biogenesis in V. cholerae and other vibrio species as well as in the other genera where this protein is found.
Statistics
?
PSSM-Id: 402516
View PSSM: pfam10972
Aligned: 21 rows
Threshold Bit Score: 146.77
Threshold Setting Gi: 123632721
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q483A4         6 ILTPALTSLCLLTScnalatnSAKVSAVeearWFEIEVIIFKQVTD-NSKNTEKFSP----------NDLTSKKRNAIDL 74  Colwellia psych...
Q87R24        18 LIPLLLLCVS-----------MPSWAAR----QFDIEVIIFKRAVD-AESTTESWPN----------QQPKIDMENVGSL 71  Vibrio parahaem...
Q7MIZ7         4 LIPLLLLCVS-----------MPSWAQR----QFDVEVIIFKRAVD-AEQTNESWPN----------QLPEITMTYAGDF 57  Vibrio vulnific...
WP_011814056  21 LSAILLLWIGGEGGsaa-vpaQASEAEE----WYEVEVIVFRQWEQ-GGRHAERWPTradlphyplwQIPAGCGDDHANR 94  Halorhodospira ...
Q0A7P2        21 LLALLLSLVGGTALll----pGTVAAEQ----QYDVELIIFRQWEA-RGDDAEAWPLsvgaphfgrwQPLGA-------- 83  Alkalilimnicola...
Q0VQS3         5 LLFVALILLG-----------NSAMAQR----WYQVEVLVFAHN---NTSNEERWAAglqp--ryasQAITIGQPESNEL 64  Alcanivorax bor...
Q2SIQ4        16 SVALYLTLFFGLMSs------SLSAYAG----LYQIDLIMFKTPVPeGEENFEYYPVaydpeapllvDFTPLSSLQKQAL 85  Hahella chejuen...
Q31GG1         6 FFTSALLFLASFSLq-----aQAETETEqdlpKYQVELIVFETLAL-RGWTEEYWRE----------DLPLIDMEGTLDV 69  Hydrogenovibrio...
WP_011913765   5 YLALLLLWLS-----------PQVHAEA----LYRVELILFRHAT--PLEASRHAPYdwa-------------------- 47  Pseudomonas stu...
Q88KZ2         6 CLTLLLALFA-----------PAAFAEG----LYQVEMILVRQNSV-PAFTSPFAPEdws-------------------- 49  Pseudomonas put...
Q483A4        75 IAP-YLQPniaslkkllpiceqqqtklpydiaitpynlwpesidteaaallseskngqdinkaqldanegvmpsakmsvt 153 Colwellia psych...
Q87R24        72 DSEaYRRS------------------------------------------------------------------------ 79  Vibrio parahaem...
Q7MIZ7        58 QDAqFRQS------------------------------------------------------------------------ 65  Vibrio vulnific...
WP_011814056  95 QEL-GIEDdpaaaeid---------------------------------------------------------------- 109 Halorhodospira ...
Q0A7P2           --------------------------------------------------------------------------------     Alkalilimnicola...
Q0VQS3        65 ADPdAIAR------------------------------------------------------------------------ 72  Alcanivorax bor...
Q2SIQ4        86 GD------------------------------------------------------------------------------ 87  Hahella chejuen...
Q31GG1        70 PS------------------------------------------------------------------------------ 71  Hydrogenovibrio...
WP_011913765     --------------------------------------------------------------------------------     Pseudomonas stu...
Q88KZ2           --------------------------------------------------------------------------------     Pseudomonas put...
Q483A4       154 vlpevtndtsgvlakddlteqgeqpqyvavdvpvynqypinrqmplcvipaeffqqhltseqfesfsidgfpvdkltnti 233 Colwellia psych...
Q87R24           --------------------------------------------------------------------------------     Vibrio parahaem...
Q7MIZ7           --------------------------------------------------------------------------------     Vibrio vulnific...
WP_011814056     --------------------------------------------------------------------------------     Halorhodospira ...
Q0A7P2           --------------------------------------------------------------------------------     Alkalilimnicola...
Q0VQS3           --------------------------------------------------------------------------------     Alcanivorax bor...
Q2SIQ4           --------------------------------------------------------------------------------     Hahella chejuen...
Q31GG1           --------------------------------------------------------------------------------     Hydrogenovibrio...
WP_011913765     --------------------------------------------------------------------------------     Pseudomonas stu...
Q88KZ2           --------------------------------------------------------------------------------     Pseudomonas put...
Q483A4       234 ngleqwrddengeitwasDTPYLIGQDSLRLKSIANRIKRSRNYAPLLHLGWRQMGE-S-KRKSKAMKL----------- 300 Colwellia psych...
Q87R24        80 ------------------KGVTLLPRSSFRLNAQEAALNNHAGFKVLKHVAWRQGDR-G-KASAPILRI----------- 128 Vibrio parahaem...
Q7MIZ7        66 ------------------KGVSMLPYSSYQLLSQKEALEKHAGFQVLLHKAWRQGDR-G-KGSAPIFRI----------- 114 Vibrio vulnific...
WP_011814056 110 ----------tddldaeeARLHCLPTERRRLTAHWGELTRSDAYQPLYHLAWLQPGF-G-RDRAVAVPVpyhwtppteae 177 Halorhodospira ...
Q0A7P2        84 ------------------RGFQRLSGNQLRLHGARQRLEQSDAYDPLLHIGWRQEGL-P-RNRSVAVPLppaw----mpp 139 Alkalilimnicola...
Q0VQS3        73 ------------------GAWLPLPQDDEVLRYMLERMESSGKYRELYHAAWQQPIG-S-ETDTLPIYI----------- 121 Alcanivorax bor...
Q2SIQ4        88 --------------------------NQVLLKWIANNLDRRSGYQVVWHKSWVSNLA---YNRDTPVRI----------- 127 Hahella chejuen...
Q31GG1        72 -----------------------LPEQQFMLASEEEKMTPEKGYYILYHRSWILQGAsEeNSQPLKIEV----------- 117 Hydrogenovibrio...
WP_011913765  48 ---------------rqaLPLERRAERQPALEHIAARLTPEQGYQVLLHRAWQQPV----SDDGPAIAI----------- 97  Pseudomonas stu...
Q88KZ2        50 ---------------agaPRLAKDAERPPALEDEATRLEATADYTVLMHKAWQQQV----GSEPSRIAL----------- 99  Pseudomonas put...
Q483A4       301 YAGEHLDLRYqqavaqqvseqqaleiqvileqrkqaeelirsqinlagneaaqattnatssmtpdnvtnnviensaafse 380 Colwellia psych...
Q87R24       129 VGGRDFSGSYnadgspingnns---------------------------------------------------------- 150 Vibrio parahaem...
Q7MIZ7       115 RAGKDYSKEYnpdgsekqaavq---------------------------------------------------------- 136 Vibrio vulnific...
WP_011814056 178 ASGQEFRDPR---------------------------------------------------------------------- 187 Halorhodospira ...
Q0A7P2       140 QAPEEWAPSL---------------------------------------------------------------------- 149 Alkalilimnicola...
Q0VQS3       122 RGDQMLINEG---------------------------------------------------------------------- 131 Alcanivorax bor...
Q2SIQ4       128 LDTERLGEGY---------------------------------------------------------------------- 137 Hahella chejuen...
Q31GG1       118 LPEEDYQP------------------------------------------------------------------------ 125 Hydrogenovibrio...
WP_011913765  98 HQGQRHFEHY---------------------------------------------------------------------- 107 Pseudomonas stu...
Q88KZ2       100 GEGTEQFGHF---------------------------------------------------------------------- 109 Pseudomonas put...
Q483A4       381 ltiaeelrqqarqqqldtlfqqlslvdnqksnfastnvdnsnesvnneeniknmvaelssdimeetvplsvnsttenqkq 460 Colwellia psych...
Q87R24       151 ------------------------------------------------------------------------ysrdgyne 158 Vibrio parahaem...
Q7MIZ7       137 ------------------------------------------------------------------------apldgite 144 Vibrio vulnific...
WP_011814056     --------------------------------------------------------------------------------     Halorhodospira ...
Q0A7P2           --------------------------------------------------------------------------------     Alkalilimnicola...
Q0VQS3           --------------------------------------------------------------------------------     Alcanivorax bor...
Q2SIQ4           --------------------------------------------------------------------------------     Hahella chejuen...
Q31GG1           --------------------------------------------------------------------------------     Hydrogenovibrio...
WP_011913765     --------------------------------------------------------------------------------     Pseudomonas stu...
Q88KZ2           --------------------------------------------------------------------------------     Pseudomonas put...
Q483A4       461 ttppIQPWSIDGLFNVHLDHYLYIDTELNIIDSSNNSSILTAKQKLANKQNttss------------------------- 515 Colwellia psych...
Q87R24       159 etinGPLYELDGKFQIYVQHYLFAETTLDLREPSVREVRFESKSTDQLNDElgdvdgnvqvgnla--------------e 224 Vibrio parahaem...
Q7MIZ7       145 vsidNPLYELDGTLQVYVQHYLFIETALDLKEPSVREITLEATPLEENAEQlgqvdgnvqlgnlt--------------e 210 Vibrio vulnific...
WP_011814056 188 -----YQPAAFGLIRIYRERFLHAVVDLRLHWRAVGREIDSAEQIRAP-------------------------------- 230 Halorhodospira ...
Q0A7P2       150 -----EPQRLYGLVRVYRERFLHAVIDLRYRRDTGDRDALLPAGA----------------------------------- 189 Alkalilimnicola...
Q0VQS3       132 ----ANVPELEGTLQFSKSRYLHVKPQVWFNTESNGERL----------------------------------------- 166 Alcanivorax bor...
Q2SIQ4       138 --------SIEGVVNLSRTRYLHTTIDLSLVEWRQKQPGGAMDEMFTPFPEqagatsalsplqqsapeekltapdsdelf 209 Hahella chejuen...
Q31GG1       126 --------KLSGTLKFYKSRYAHVRLHLELERKIPQQVTEEFAANQSMDPEmlp-------------------------- 171 Hydrogenovibrio...
WP_011913765 108 --------PIQGTLKLRPGRYMQTDMTFWVNRFGEYGQLLA--------------------------------------- 140 Pseudomonas stu...
Q88KZ2       110 --------PIEGNLSIAEGRFITVEANFWVNQLDGNGSVLQ--------------------------------------- 142 Pseudomonas put...
Q483A4       516 ---------rnkVISFKQD-RRVITGEIHYFDHPHIGMIVQIRRF 550 Colwellia psychrerythraea 34H
Q87R24       225 isptvteetflkSYRLDQK-RRMKSSETHYLDNPLMGMIIQVRRV 268 Vibrio parahaemolyticus
Q7MIZ7       211 vtptvtveqflkSYRMDQK-RRMRSGETHYLDHPLLGIVIQVRRV 254 Vibrio vulnificus YJ016
WP_011814056 231 ------------LHRMSEH-RRMRSGELHYLDHPALGVLMVIHPA 262 Halorhodospira halophila
Q0A7P2       190 ------------VHALQQS-RRMRSDELHYLDHPVLGVLIQIRPV 221 Alkalilimnicola ehrlichii MLHE-1
Q0VQS3       167 ------------YVKIDEK-RRLTGHQIYYFDHGLFGMLIRITQA 198 Alcanivorax borkumensis SK2
Q2SIQ4       210 leetfrglepvaRYRNRQS-RRMRSGEVHYLDHPVVGVLVKIIPV 253 Hahella chejuensis KCTC 2396
Q31GG1       172 ---------efwRFQLQEA-RKVKSGELHYFDHPIFGALVKIQYK 206 Hydrogenovibrio crunogenus XCL-2
WP_011913765 141 ------------SERLTQR-VRLVPGRLTYIDHDSLGLLIELRRL 172 Pseudomonas stutzeri
Q88KZ2       143 ------------SEQFRQSnSNVKGGQLTFLDGGHLAVLLKVTPP 175 Pseudomonas putida KT2440
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap