Conserved Protein Domain Family
DUF2770

?
pfam10968: DUF2770 
Protein of unknown function (DUF2770)
Members in this family of proteins are annotated as yceO however currently no function is known.
Statistics
?
PSSM-Id: 371319
View PSSM: pfam10968
Aligned: 5 rows
Threshold Bit Score: 29.6737
Threshold Setting Gi: 488988212
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P64442          10 MRRLLHYLINNIREHLMLYLFLWGLLAIMDLIYVFY 45  Escherichia coli K-12
ACR69513         2 FNRLIHRFIDSVRHHLLFYLAVSLLLLAFDLYYLWF 37  Edwardsiella ictaluri 93-146
WP_002898988     1 MRRLFNMLVNNVREHFMIYLALWLLLAIIDLVWLWF 36  Enterobacterales
Q7CQR4           1 MRRLFHFLMNNIREHFMLYVILWSLLAVMDIVYLLF 36  Salmonella enterica subsp. enterica serovar Typhimurium
wugsc:CKO_02007 18 vRRIFHYLINNIREHFMLYVILWSLLAIMDIIYIMF 53  Citrobacter koseri ATCC BAA-895
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap