Conserved Protein Domain Family
DUF2766

?
pfam10964: DUF2766 
Protein of unknown function (DUF2766)
This family of proteins with unknown function appears to be restricted to Enterobacteriaceae.
Statistics
?
PSSM-Id: 371318
View PSSM: pfam10964
Aligned: 4 rows
Threshold Bit Score: 115.4
Threshold Setting Gi: 506351313
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q2NTD1        1 MTKPFTENQELVSDLVACQLVIKQILDVIDIIAPAEVRDKMSAQLKNIDFGTHPAARDPITRRAIEKAIALIDMKFdlST 80  Sodalis glossini...
P0AD10        1 MSQPLNADQELVSDVVACQLVIKQILDVLDVIAPVEVREKMSSQLKNIDFTNHPAAADPVTMRAIQKAIALIELKF--TP 78  Escherichia coli...
KFD05318      1 MSESLNREQEIESDLVACQLVIKQILDVIEIIAPAEVREKMSHQLKSIDFSKHPAGADPVTKRAIEKAISLIELKF--TK 78  Rahnella aquatil...
WP_015871032  1 MSQMLNERDELASDLVACQLVIKQILDVIEVIAPAEVRAKMALQLKSIDF-NQP-GIDEVTQRGVQKAIALIELKF--SR 76  Edwardsiella ict...
Q2NTD1       81 P 81  Sodalis glossinidius str. 'morsitans'
P0AD10       79 Q 79  Escherichia coli K-12
KFD05318     79 H 79  Rahnella aquatilis CIP 78.65 = ATCC 33071
WP_015871032 77 e 77  Edwardsiella ictaluri
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap