5MSL


Conserved Protein Domain Family
DUF2757

?
pfam10955: DUF2757 
Click on image for an interactive view with Cn3D
Protein of unknown function (DUF2757)
Members in this family of proteins are annotated as YabK however currently no function is known.
Statistics
?
PSSM-Id: 402506
View PSSM: pfam10955
Aligned: 17 rows
Threshold Bit Score: 85.0062
Threshold Setting Gi: 505138748
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5MSL_A          3 MALHYYCRHCGVKVGSLE-SSMVSTDSLGFQHLTNEERNDMISYKENGDVHVLTICEDCQEALDRNPHYHEYHT 75  Bacillus subtilis
WP_015325850    1 MNLVYRCPQCQKVIDQLAvPGEIDDEALGFNVLTAEEREDIIEVEED-NTYVNVVCDECAQDYAANQTLYNTqi 73  Halobacteroides halo...
WP_008408283    1 MPVRYRCRHCEVEIGTLP-F-DAEETVQKLHLFEIGEIDEFIKKNERGETTVYSICEHCEESLRQFPDYYALKR 72  Solibacillus
jgi:Theco_3717  1 MAVNYVCRHCRTPLGSLD-RDDLSEAALGFHFLTPEERGDIIAYDAAGNVTVRVICDYCREALEANPElllies 73  Thermobacillus compo...
WP_013486688    1 MAIHYYCRHCSKNVGTLS-DWQANDEQLGFNQLTNEEKQEMIECNSQGHLQVKVICEDCEKTLQENPDYHAQES 73  Bacillus cellulosily...
BAM46189        1 MLIHYRCKHCYTTIAELS-HDRLNLEQLGFNQLTDEEKREMIYYHHPNEADVFVICESCESALYHYPNYRELEF 73  Amphibacillus xylanu...
WP_014641363    1 MKIHYYCRHCQRQVGELD-AKHVDVSQLGLDLLNEEDHQQMVHMHANGDLNIRTICDSCKETLDQHPHYHELDF 73  Halobacillus halophilus
Q8EU32          1 MAIYYDCRHCGQQIGKLE-QKEIDVSLLGFDQLTNKDLTDMIYYDQDGNMRVKSICENCQRTLEQHPNYHELDF 73  Oceanobacillus iheye...
Q5WAD5          3 MAVYYGCRHCGQTIGVVF-ENATEAD-LGFHELNEMEKDELLTYYENGDIHVKAICEDCYTALSDNPQLYSYPY 74  Bacillus clausii KSM...
jgi:Bcoa_1243   1 MAVHYYCRHCGTKIGTIT---DIEADRMGLFFLTDEERQEMVLPQEDGSVRIQSICEECQDSFEREPAFHQYGY 71  Bacillus coagulans 36D1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap