Conserved Protein Domain Family
DUF2755

?
pfam10954: DUF2755 
Protein of unknown function (DUF2755)
Some members in this family of proteins are annotated as YaiY however no function is known. The family appears to be restricted to Enterobacteriaceae.
Statistics
?
PSSM-Id: 402505
View PSSM: pfam10954
Aligned: 3 rows
Threshold Bit Score: 152.293
Threshold Setting Gi: 488373647
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
wugsc:CKO_02799  10 MADFTLSKSLFSGKHRDTsSTPGNIAYAVFVLFCFWAGAQILNLLVHAPGVYEHLMQMQETGRPRVEIGLGVGTIFGLVP 89  Citrobacter ...
WP_002890210      1 MAEFSFSKSLLGNKKRGA-LTGSHVAYGLFVLICCWAGAQMLSMLIHAPGVFERLMQAQDASRPQVDISLAVGTLFGLIP 79  Enterobacter...
WP_002443032      1 MAGILSPKSFVSDIRREF-SSSGNVSWALFVVLCLWGGSEILRLLVHAPGLIEHIMQTHSSARPAIEMSPSVGLLFGVVP 79  Shimwellia b...
wugsc:CKO_02799  90 FLTGCLIFGVIAVILRWRHRH 110 Citrobacter koseri ATCC BAA-895
WP_002890210     80 FLIGCTFIGVLALIVRWRQRR 100 Enterobacteriaceae
WP_002443032     80 VIAGLVILGAVVLCIRLR-RR 99  Shimwellia blattae
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap