3DZA


Conserved Protein Domain Family
YfdX

?
pfam10938: YfdX 
Click on image for an interactive view with Cn3D
YfdX protein
YfdX is a protein found in Proteobacteria of unknown function. The protein coding for this gene is regulated by EvgA in E. coli.
Statistics
?
PSSM-Id: 402494
View PSSM: pfam10938
Aligned: 38 rows
Threshold Bit Score: 81.9505
Threshold Setting Gi: 338806038
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3DZA_C          35 AXRDIQFARLALFH-GQPDSAKKLTDDAAALLAADDASWAKFvktdak-------------------akxiadRYVIINA 94  Klebsiella pn...
jgi:Metme_4330  48 AVRELKWARVAIFD-GNIPQAKDLLGKSKQQLAEVEKQAPELivtvkteqkiagk-------tvdhdkktitddLVPIDA 119 Methylomonas ...
jgi:Thimo_3559  75 tMRYVTSARLAIFN-GLPEKARTFADAARARADAAVKDADAYvldake--------------------pkaedMYVPFDA 133 Thioflavicocc...
Q5FTT0          48 AFQDIMNARDILQTgGKTEAAIPALYDAQKRLAAAEKADKKFqaaendlhpapqh-----pvaanhqpvvgqtDWLPVGG 122 Gluconobacter...
CAP54989         1 -MTDIVTARQLVAQ-GKVDQAVPPLYDAQKRLEAARKAEKRYnvaesalqpapqh-----plpsnhpvtstpiDWVPVGG 73  Gluconacetoba...
BAH98508        48 AMMDVFQARDLLAQ-GKTDAAIPPLYDAQKRFKAASADNKKFfaaesqlqpapqh-----pvsanhtpvanptTWVPVGG 121 Acetobacter p...
WP_003622143    45 AFDDITMARTALAN-GDTAGATKLLTDANNAFTRAKTDNRVFmkaesqlskpkkvpa--gapvpttapntqpvAWLPVDG 121 Komagataeibac...
jgi:Gdia_2572   55 AYADIDMARQALAQ-GDKAGATKLLADANQALDRAQGDDHRFvraeaaltpapkapagkpghlpaptaptqdvTWIPVDG 133 Gluconacetoba...
jgi:Bind_1732   50 AFEDIELARQAIYD-GDTQSAVKLVAEAQQALTRAKADDSQFlkaaselspapkts---adaakpeadaaksvAWIPVDS 125 Beijerinckia ...
BAI00621        80 AFEELMLARRAIFD-GDLKGAKTLITSAQQALDRARADNTAFqkaeaelmpvktkq---aqtakkgtgsttpvAWLPIDG 155 Acetobacter p...
3DZA_C          95 SIALSEDYVATPEKESAIQSANEKLAKGDQKGAIDTLRLAGIGVIENQYLXPLNQTRKAVAQSQELLKAGKYYEANLVLK 174 Klebsiella pn...
jgi:Metme_4330 120 GLTLADDFVVTPEKQEKINKANEHLKNKEPAKAVQVLREADIGISVTRELMPVKNTIKHVDKAIELVDQHQYYEANLALK 199 Methylomonas ...
jgi:Thimo_3559 134 GLVVAEDFTVTPEKMKHITKANKHLHKGETQAALDALKQGAVDVAVTTKLIPVKFAQVHVDDATKLLEEGKYYEANLALK 213 Thioflavicocc...
Q5FTT0         123 EFIVNETL--APEKKTAVASANAQLKSGNTDQAAETMKVVGEDTDFILALAPITPVQGAVYRATVFTEGHHPQEAVDALN 200 Gluconobacter...
CAP54989        74 AFIASDIL--SPEKKAAVAKANDQLKAGDSKGAAQTMQVVGEDVDFIVALAPLDQTEGAVNRATVFVEGRQPAQAAEALD 151 Gluconacetoba...
BAH98508       122 EFIVSETL--APEKQAALANANKQFQAGQTQQAQQSLQVVGEDADFILALAPLEQSEGALYRAKVFTEGRQPQQAVEALN 199 Acetobacter p...
WP_003622143   122 EYIVTEDLEPTSAKGTAITAANASLNKGKTAQASQNLQVAAVDVDFVLAIAPLQASADDVYRATNLLAGKDTKGADAALA 201 Komagataeibac...
jgi:Gdia_2572  134 EYVVSRDPEATPAKAQAVQAANSSLKKGDTASTSHALANADIDVDFIIAVAPLQPVTADVYRASNLVN-TDPHGADTALA 212 Gluconacetoba...
jgi:Bind_1732  126 EFVLNENLAGSRVKSAAVATANRHLRQGKAGKAHEVLKVTGAEADFILVVAPLQDTIDTVAHAASLLESHDYYNANLALK 205 Beijerinckia ...
BAI00621       156 ELVLDETVEPTTEKSAAVAAANRHLRAGDPDRASEVLKVSGVDADYVIAAVPLEQTRQDVNRAAEFIK-NDPYKASEALR 234 Acetobacter p...
3DZA_C         175 GAEEGIVVDSE 185 Klebsiella pneumoniae subsp. pneumoniae MGH 78578
jgi:Metme_4330 200 AAQDGLIIDSV 210 Methylomonas methanica MC09
jgi:Thimo_3559 214 AVEDAMVIESY 224 Thioflavicoccus mobilis 8321
Q5FTT0         201 QALDSVIFVSE 211 Gluconobacter oxydans
CAP54989       152 QALNGLVFVSQ 162 Gluconacetobacter diazotrophicus PA1 5
BAH98508       200 QLLDGIVFVSD 210 Acetobacter pasteurianus IFO 3283-01
WP_003622143   202 DAQNSIRFVTE 212 Komagataeibacter hansenii
jgi:Gdia_2572  213 DAQDALRFIAD 223 Gluconacetobacter diazotrophicus PA1 5
jgi:Bind_1732  206 QAQDGLRFISK 216 Beijerinckia indica subsp. indica ATCC 9039
BAI00621       235 DAENSVRYASV 245 Acetobacter pasteurianus IFO 3283-01
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap