Conserved Protein Domain Family
DUF2827

?
pfam10933: DUF2827 
Protein of unknown function (DUF2827)
This is a family of uncharacterized proteins found in Burkholderia.
Statistics
?
PSSM-Id: 402489
View PSSM: pfam10933
Aligned: 20 rows
Threshold Bit Score: 445.921
Threshold Setting Gi: 514684376
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_014004442          6 VGISIFPVQGAQ-LWSNGLNQNLAFLVLLLQQSPQVGRVFLLN-GGALDHMPDAMGLNGLDVPLVKPQDVTFELDVVIEM 83  Collimon...
WP_127058643         19 IGITFFWGSTYKhIWSNGAGQNMYFLREMLAQIDGVDDVYFVFwGNDLKTLPKELEIEAMGVDIFPYEEVVKTTDVLIEG 98  Veillone...
WP_127059401          7 IGITFFWGDSYQhIWSNGAGQNMFFLKLCLEQIEFVNEVYFVYwGNELTSLPSQF--QGFNVKYYEYHEVLNKTDLLIEG 84  Veillone...
jgi:Fraau_1202       13 VGITIGLASESEtLWNNGIKQNAIFLAETLRHCPNVSSVVLVN--TTSVRISKALPWDLDRWPVIALAEAKDGLDVLIEL 90  Frateuri...
WP_025329669         24 IGITIGLSHPKEtLWNNGIKQNAVFLADALKNCPNVDSVVLVN--TTDVPVTSSLPWDLEIWPTKSFLEAKDQIDVLIEL 101 Snodgras...
nioo:CFU_0449         8 IGITIGLHQENEsLWNNGIKQNAVYLAETLKQCPSIASVHLVN--TTVVAITAALPWDQARWPTVTFEQAKDNLDVLIEL 85  Collimon...
WP_014890888          7 IGITIGLSSPNEsLWINGIKQNALFLAKLFQSSPLNHDVVLLN--TTNVRPDSRTEWDMRAFPTVQIDQYSRDLDVLIEL 84  Methyloc...
Q63KC0               25 IGITIGLREPNEsLWINGIKQNALFLAKLLMKSSRGYRVTIVN--TTDVPITDALPWDRRIFDTRSFADVKDSLDVLIEL 102 Burkhold...
wkYale:SALWKB2_0010  17 IGISVITHANQN-IWENGMSQNIIFLVQSLKAIPFVKSVDLIN-VGGQPGMAEQIDLSLFDLRLLSEQEAEDAFDVIIEL 94  Snodgras...
WP_014890901          3 VGLSVLTRAGQS-LWENGIGQNVVFLADLLKNAPLVEGVCLLD-CGDQGALPGDAPAEFRSLPLIPLGSAGDVVDVAIEI 80  Methyloc...
WP_014004442         84 GAQLPLEWLRHVRALGVKIITFFVGHTFADNAEAPMFDRPS--GQIFNGTPWHEIWTLPQFMKSSGPLLRTVSRVPVFAI 161 Collimon...
WP_127058643         99 TLTLEPKYEKEFRKYGAKIVTFRMGSDFIMDMEKFVNKKDG--GRGFNGCTFDQVWLIPQVYKTNKDYLEVMTGTKAYKV 176 Veillone...
WP_127059401         85 TLALEPAIGRAFRAQGARIISYRMGNDFIMDMEKFVHAEQG--GRAFNGTRYDAVWIAPHLMKTNKPYVEIITRAPVYEV 162 Veillone...
jgi:Fraau_1202       91 GGQVDADMTRHLKSRNARLVSYCCGFEYVHAMQSVIFGRPMwgDKLFVNQHYDAIWMVPQVAAGSQHYFQTLRRRPARTI 170 Frateuri...
WP_025329669        102 GGQISAEQTAYIKDRGVRLISYCCGFEYIHMMESILFSRNMggANLFINQRYDDIWMIPQVANCSQAYFEVFRRHDARVV 181 Snodgras...
nioo:CFU_0449        86 GGQISADQTAYLKTQGCRLISYCCGFEYVHVMQSVLFNRPMwgYDLFVNQRYDAIWMVPQVATNSQSYFETLRRRPAQVV 165 Collimon...
WP_014890888         85 GGQISDAQTQRHKAKGGKLVSYCCGPEYVQNIEAIIFERRLw-DSIFVNADYDELWVIPQVAESSLHFLQTFRRCPARVV 163 Methyloc...
Q63KC0              103 GGQIDGEQTAYLKARGVKLVSYCCGFEYIHATQSILFGRRMw-DTLFINRGYDEIWAIPQIAPSSLPFLQSLRRSPGRVV 181 Burkhold...
wkYale:SALWKB2_0010  95 AGALNPQWLALQRARGKKVVFYCVGQPYVGLAEFNVFEKPT--SFPPVDRS-DEVWVLPK-DKDYIPMLRTMYRCPVHVT 170 Snodgras...
WP_014890901         81 AGGLDIEWVRRFRARGGKIVCHICGQPYAALVEFSVFDR-S--GYWGDPTRADEVWILPK-DRAFAPMLRSMHRCPVEIV 156 Methyloc...
WP_014004442        162 PHIWSPLFIQEHVEVVErGGHQFGYQARTGIdrpgWR------------TAIFEPNISVGKNCFIPMLVCEQAYRLDQRS 229 Collimon...
WP_127058643        177 PHVWSPFFFDRQVANLQ-DGLSFGYNPDKSKr--gRR------------ITVIEPNISVLKNCYTPVLIAEAAYKKDPEA 241 Veillone...
WP_127059401        163 PHLWSPLFIDTKIKELSlEGI-FGYNPIDPEq---RR------------VAVMEPNISVLKNCMTPILIAEEVYRRNKNL 226 Veillone...
jgi:Fraau_1202      171 PFVWSPVLLEQRAADLSvDPV---HVPHAGP----QR------------LTVMEPNIDVVKFCLYPILIAEEAYRNDPES 231 Frateuri...
WP_025329669        182 PFVWSPVFLIQKTAAMPfQGLW--QVPTSRKg---WR------------LSIMEPNIDVVKFCLYPILIAEMAYRTEPEA 244 Snodgras...
nioo:CFU_0449       166 PFVWDPIFVNQRSQGFEhHGE---YRPRSGP----KR------------LTVMEPNNDIVKFCMYPAFIAEEAYRQQPQD 226 Collimon...
WP_014890888        164 PFVWDPMALTSIASGYAfGGE---YRPSGRP----KR------------LTVIEPNIDVLKFCLYPILIAEQAFRREPDA 224 Methyloc...
Q63KC0              182 PFVWDPMFLGERTRLLPeRGE---YRPSGKRa---KR------------LTVMEPNHDVVKFCVYPMLIIDEAYRREPDA 243 Burkhold...
wkYale:SALWKB2_0010 171 PYLWDPMFISRRKQEISeHGFYFG-----------WRgnlqdgvktplnVAIFEPNISVVKTSSIPMLACDEAYRAEPQS 239 Snodgras...
WP_014890901        157 PYLWAPNVLEDSITKARsEGLEFGYRPGPGGvksgAR------------IGIFEPNLSPIKTCVISAMICDALNREAGPV 224 Methyloc...
WP_014004442        230 VSMMMVMNTVHMKEHPT-FNRFAINLDLTKHHKASYEPRVAFVECMAQQkMDAVVSHHWEWGLNYLYYDTLYGGYPLIHN 308 Collimon...
WP_127058643        242 ISHVYLCNTYDVRDISG-FHNFIGYTTLVKNNVMTVETRHLLPYFLSRY-TDIMLAFQWELGLNYTYYEALYGNYPLVHN 319 Veillone...
WP_127059401        227 LKHVYLCGTVDKKNVHA-FYNFIGFTDLVRQNIMSVEARFMTPEFLGKY-TDIVLAFQWECGLNYLYYEALYGGYPLVHN 304 Veillone...
jgi:Fraau_1202      232 IAFLHVTNAEHLATRSPeFISLMGHLDLVRNHKASFVGRYDTARFLAEF-TDIVISHQWDNPLNYFYFDVCWLGYPLLHN 310 Frateuri...
WP_025329669        245 INILQVCNTLPMAQKSMeFIALMNQLDIVKNRKSVFLGRYDTPTFLATN-TDAVISHQWENPLNYFYLEVCWQGYPLIHN 323 Snodgras...
nioo:CFU_0449       227 VEILHVTNAERLARESKeFIAVMNQLDIVREHKAVFLGRFDTPQFLSQM-TDVVISHQIENALNYFYFDVCWQGYPLVHN 305 Collimon...
WP_014890888        225 IGFLHVANADHFVHRDTeFAGLMRHLDIVKANKASFIGRVKTPAFLAEY-TDIVISHQWGLPLNYFYLECCWQGYPLIHN 303 Methyloc...
Q63KC0              244 IAFAHVTNAERLAHDSPeFVMLMNYLEIVRASKASFVGRFDTPTFLAEH-TDVVVSHQWENPLNYFYFDVCWQGYPLVHN 322 Burkhold...
wkYale:SALWKB2_0010 240 IGMMHVLNTLHMKDHLT-MLYLANSLNLVKDHKACFYGRHDIAGFMAQH-ANAVVSHQWCNDQNYLYLDALYGDYPLIHN 317 Snodgras...
WP_014890901        225 VESVNLYNGAHMQGQTT-FDFFRHSLSLHDENKIAVHGREYFVRAMSRS-CNVVISHQLQCEQNYLYLDALYGDYPLVHN 302 Methyloc...
WP_014004442        309 SEYLkaGGVGIYYPDFEASAGGHALLDAW-NQEPEFWDDYKKAGTAYLSKLDPVRPENVEAFVKRL 373 Collimonas fungivorans
WP_127058643        320 SPILldAGVGFYYPEFDAQRGADVLLDVI-NNYDAQIEIHKKHNQAFLETLSPYNPAVYSEYEKLL 384 Veillonella ratti
WP_127059401        305 SEYLkkENIGFYYDQFDAYAGADALINAI-YAYDKEKDYHELHNRKYLGTLSPFHENNIANYEMLI 369 Veillonella ratti
jgi:Fraau_1202      311 ADLC--RDLGYYYPGNDVQSAAAMLRRIIvAQEDFDAAAYRQTQRSAIARFLPENRHVVETYTELL 374 Frateuria aurantia DSM...
WP_025329669        324 AELI--SDLGYYYQGNNVEEGAKQLFAAM-SDHAYNAAHYVYDQRQQIARFLPNNTDLVASYSALL 386 Snodgrassella alvi
nioo:CFU_0449       306 AYMC--SDLGYYYEGNNVKEGSRKLLEVL-NSHDAGWQDYLARQRQVLSHYLPGCPQVTAEYERLL 368 Collimonas fungivorans...
WP_014890888        304 AELV--KDLGYYYPGNDVAVATESLVRAL-RQHDEAWEAYRDEQRAGIQKFLAVNPELVAQYDNLL 366 Methylocystis sp. SC2
Q63KC0              323 AHLV--PDIGYYYPDNDVQTGAEVLMRVL-REHDDDWEGYAARQRSLLRRYTSKNPTLVAEYDTLL 385 Burkholderia pseudomallei
wkYale:SALWKB2_0010 318 SPWLkeFGAGYYYPDFNAAEAGRQLIFAW-QHHEENLGSQRQASQALFKATSPLTEANIAAHVQLL 382 Snodgrassella alvi wkB2
WP_014890901        303 SPLF--AHVGYYFEDCDITEGVNQLRRAC-LTHDENLERYRARARAEMDRLSPHNPANAAAYVRRL 365 Methylocystis sp. SC2
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap