Conserved Protein Domain Family
DUF2700

?
pfam10912: DUF2700 
Protein of unknown function (DUF2700)
This family of proteins with unknown function appears to be restricted to Caenorhabditis elegans.
Statistics
?
PSSM-Id: 371296
View PSSM: pfam10912
Aligned: 26 rows
Threshold Bit Score: 69.1996
Threshold Setting Gi: 0
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
EFP09296      44 MLQIFALIKFGAVLYIATnRQFDEKEIPIvvfVLGVNAFILFSATCQDFCTLILSWIVSMSAFVLYILLLVTVPIFVTSF 123 Caenorhabditis ...
3_pfamImport   8 VLAIIGVGFDICAILSSK----IGLFQLV---FVVIDALLLYGVIRMDEPSLNVARVAVSINIFFAALQALIFPVLLSSL 80 
EGT34644      23 AFALIGIVGSPCLLVYCSdTLPTTYAGCAf--GWLLHFILLFGVLKNNEIAMNLTISLLIIVLILDFFLFLIVPIVTGSL 100 Caenorhabditis ...
EGT31719      25 TLATIGIIGSPPFLYFDPtSTVTYLAIFF---SLTLHFCILFGAWKTDERFLRNSEKLSKFLIFINSLQFCTVPAIVGCL 101 Caenorhabditis ...
EGT34645      19 TLSIFGIFGS---LLTCGsERFLAFGSIF---SFIFYCFLLFGTIRYNVKVLDCCRKLLAFFLFLHVILMFFLPVVITSS 92  Caenorhabditis ...
CAP39172      16 VVSFLGMLSAPSLLLVKPlSTTSHIASVI---TLAFNGCLFGGALKYNNKALKCCQNVLVCLIVFYFILLCLTPMTFSRF 92  Caenorhabditis ...
EFP02431      20 FFSIFGLIECLWQSVFNG-DLVTKTTGFV---SSALEIVLLYGVIKNQSKLLKVSMYISLIHLTFDFGGILVTPVYFASQ 95  Caenorhabditis ...
Q5TEB3        20 FFSIFELFLCGWQTVLNE-DRITRTTGTI---SAILTLVILYSVVKNRASLLKIAMYISIFQLAFEFGEILVTPVYFSSQ 95  Caenorhabditis ...
EGT56495      21 FFCFLTII-SDFICKYTPnAHFSHLFLGT---SPLLEILVIAGVLLNSPKATKFAFYVCRIDVIIGFICLFTLPVISVAE 96  Caenorhabditis ...
Q8MPY3        21 SYCLVGII-LDIYFKYTPdLPWTHLITGT---SPSLELIVIGALLMNSSTGNNIAYYVCTVDVIIGILCLLTLPVISVAE 96  Caenorhabditis ...
EFP09296     124 FASDAARSVRi-----------pAEWKIFRDIINyq--------sVEERRFTEGINYGMSVEFFLAILVTITAIQFILIN 184 Caenorhabditis ...
3_pfamImport  81 AASGTLD----------------RTTLRFKQLFVse--------fNEGSHFWSGLLVGYLLEIIFAIFIGIQVLKFVAVH 136
EGT34644     101 VSSDYVKFMYpeppykimkncieKSREQVSEMLRtk----------aETKFWNGLKMAADSGTKIALHFAVVVMEYTLSK 170 Caenorhabditis ...
EGT31719     102 VSSGC------------------KKWSIFFSIFNdqqffglnegsSSEEKFKSGLLASFISAVLILFPLGFLVTEYYLIK 163 Caenorhabditis ...
EGT34645      93 MASKSLGTLGpk-------------------------------enQQKNQFWLGVLAGLATEMFIVLGASVMYLKYVMVK 141 Caenorhabditis ...
CAP39172      93 MAYGYDQFLRyep--------veDLANRLKRTVGddefshekarkEAEAKFILGLLVG------------VSIVVVIIIH 152 Caenorhabditis ...
EFP02431      96 VASGY------------------ESNDTYPNILGvk--------tAEEDRFVVGLVTGYSVEILSTAGVALSVLQFILIN 149 Caenorhabditis ...
Q5TEB3        96 VASGY------------------ESNDTYPNFLGvk--------tAEEDRFVIGLLTGYSVEIIMTISVTLSIIKFILIN 149 Caenorhabditis ...
EGT56495      97 NATGIHLNL--------------PLVATFHTGFKie-------vqSEIEMFYVIVMLGFISTALIGLFLIFDVIKYrclq 155 Caenorhabditis ...
Q8MPY3        97 NATGHHLRL--------------PFVSTFHSSFKfq-------vtSTLDVFYITIFLGFVSTLLILLFLGLDMLKFMLLR 155 Caenorhabditis ...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap