Conserved Protein Domain Family
DUF2715

?
pfam10895: DUF2715 
Domain of unknown function (DUF2715)
This family of proteins with unknown function appears to be largely found in spirochaete bacteria. It is related to membrane beta barrel proteins.
Statistics
?
PSSM-Id: 371289
View PSSM: pfam10895
Aligned: 13 rows
Threshold Bit Score: 107.017
Threshold Setting Gi: 763134553
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
O83367                  60 FCAD---VFFSSHL------------------------------------------------------------------ 70  Trepo...
PRJNA257944:JO41_07705  19 FAGHd--IILAPSV------------------------------------------------------------------ 30  Trepo...
SLUandSVAtrep:TPE_0339   8 FAKQkddVIISVTQ------------------------------------------------------------------ 21  Trepo...
WP_021329094            39 FAAE---FILSPTI------------------------------------------------------------------ 49  Trepo...
SLUandSVAtrep:TPE_0693  19 FAAE---VVFSPGI------------------------------------------------------------------ 29  Trepo...
PRJNA257944:JO41_06440  33 FAAE---IIFSPGI------------------------------------------------------------------ 43  Trepo...
WP_044014230            27 VDRRgafLIDSPKVikehniiedkilpyiaevleynnpsgtndpqaaqyfrtvktvnnmnsdkfvdcqdyallfyalcky 106 Trepo...
O83696                  18 GALE---LFLSPKI------------------------------------------------------------------ 28  Trepo...
O83164                  24 YAGY---VFVSPKLgvygeal----------------------------------------------------------- 41  Trepo...
O83628                  53 VAAR---VSLSPKLgvygdar----------------------------------------------------------- 70  Trepo...
O83492                  57 FAAE---VFVSPKV------------------------------------------------------------------ 67  Trepo...
O83695                  27 NAAQ---VFVSPRV------------------------------------------------------------------ 37  Trepo...
O83366                  23 FCVQ---AFISSRI------------------------------------------------------------------ 33  Trepo...
O83367                  71 ---------------GYGRFYAVGKDIE-------------GQHMHVPSIG-GGVCVV-ADSG----------------- 103 Trepo...
PRJNA257944:JO41_07705  31 ---------------GYTYTNAFTVKNPidpss----eninYFKAHNGYLE-FTVGLI-LNNG----------------- 72  Trepo...
SLUandSVAtrep:TPE_0339  22 ---------------GYTNMSTILTTPLdlt-------vndKLSSHNYNLG-LTAGVI-LDNG----------------- 60  Trepo...
WP_021329094            50 ---------------GFSNTSSIGIAVAqegshagdretckMYFNHMP-VG-ITLGLI-TNKG----------------- 94  Trepo...
SLUandSVAtrep:TPE_0693  30 ---------------GFSVYTVRSHEVIikgknlelsdkpvTYTIPTPSIG-LDMHFIhEKNG----------------- 76  Trepo...
PRJNA257944:JO41_06440  44 ---------------GFSSYTVRSYEVIisggtlntsdkaaTYTIFAPAVG-LDMHFThENSG----------------- 90  Trepo...
WP_044014230           107 ynidcklvgnptlrhAYNQLNVRG-----------------HAVDVEPQSGeGTVYFV-AQHGwelsenglfikrinthp 168 Trepo...
O83696                  29 ---------------GITSVYQFGSNGGsdgt------ssgKGVSFDRLIGrVDLGLI-LVNG----------------- 69  Trepo...
O83164                  42 ---------ggpdtvGKAVKQADGTKIApk---------iwYYAPRTPLFG-VDIGYQ-ADNG----------------- 84  Trepo...
O83628                  71 ---------ggsdlwGICIQAPTMPDTEnqa--------ppRYAPETPLVG-LDVAFR-AENG----------------- 114 Trepo...
O83492                  68 ---------------GQVGAHPWGKEPApr----------tDVLLYTPTLG-LAVGVI-AHNG----------------- 103 Trepo...
O83695                  38 ---------------GQVGVFVWGKGANgeggtq--gtkrtDILAFTPTLG-LSVGVS-AENG----------------- 81  Trepo...
O83366                  34 ---------------GYGRFGIYGNEIKd------------SYYKHVPMTG-LGVDVV-TSSG----------------- 67  Trepo...
O83367                     --------------------------------------------------------------------------------     Trepo...
PRJNA257944:JO41_07705     --------------------------------------------------------------------------------     Trepo...
SLUandSVAtrep:TPE_0339     --------------------------------------------------------------------------------     Trepo...
WP_021329094               --------------------------------------------------------------------------------     Trepo...
SLUandSVAtrep:TPE_0693     --------------------------------------------------------------------------------     Trepo...
PRJNA257944:JO41_06440     --------------------------------------------------------------------------------     Trepo...
WP_044014230           169 dnivmdidewnaygkegrfvspanmelfnyvvknghlpnwemrsnypmpdlltgnsvllltpsigynysyygvdttarks 248 Trepo...
O83696                     --------------------------------------------------------------------------------     Trepo...
O83164                     --------------------------------------------------------------------------------     Trepo...
O83628                     --------------------------------------------------------------------------------     Trepo...
O83492                     --------------------------------------------------------------------------------     Trepo...
O83695                     --------------------------------------------------------------------------------     Trepo...
O83366                     --------------------------------------------------------------------------------     Trepo...
O83367                 104 ------------------FAFACTVDAA---------------Ltr-----iMLKTQALFGYAFRWGA--FSLIPLLGMD 143 Trepo...
PRJNA257944:JO41_07705  73 ------------------FTYIEDAGFAagpayvtddqirvpsF--------FFISRSLLGYTFKPTQn-LYINLLTGIG 125 Trepo...
SLUandSVAtrep:TPE_0339  61 ------------------FTFLEHTDFAagv----------syFnsikslsfLVELHSVIGYTFRPSQn-AYINLLTGLG 111 Trepo...
WP_021329094            95 ------------------FTFMVNNDFSpigkgtmklkddsgnLkld--kniIFQQSVFFGYTFKLVNqkLFINIGSGFI 154 Trepo...
SLUandSVAtrep:TPE_0693  77 ------------------FTFSLINNAAfpiamykrggfgngsMktk---gfIWDGQMLFGYTYGVKQp-LSIHAGIGPG 134 Trepo...
PRJNA257944:JO41_06440  91 ------------------FTFSLINNAAlpvgiyksggfgaesMkvh---gfIWDGQMLFGYTYGIKQp-FSIHAGIGPG 148 Trepo...
WP_044014230           249 dqftfginwlqvarpptrWSYMIGADWAiggkitekntsraqwGepytafssVLSAHLLIGYTFNVKD--FYLTPAGGIG 326 Trepo...
O83696                  70 ------------------LTISASAESS---------------Ltn-----vFVRAQALIGYAVRVGG--LRAIVSSGVN 109 Trepo...
O83164                  85 ------------------LLFRVNLDAA---------------Ltr-----lMFRSQCVVGYSLRFGWggGYVSIASGIE 126 Trepo...
O83628                 115 ------------------FLLQLTVDAA---------------Ltr-----lMFCGRCLAGYSFRPGEgsTHLSVAAGFE 156 Trepo...
O83492                 104 ------------------FAFTTELDAG---------------Laf-----lMFRAQFLVGWAIRSGKn-FAFIPSLGVD 144 Trepo...
O83695                  82 ------------------FTFVTQLDAG---------------Lst-----lLFRAQFLLGWVLRMGEr-AFFLPSTGVD 122 Trepo...
O83366                  68 ------------------VAMVFNVETA---------------Ltq-----lMFRAQALLGYAFEVGR--FRFTPAIGGS 107 Trepo...
O83367                 144 V-------------------------------------------IVSSDh-------------aFGVAAQVSFQHLISEW 167 Trepo...
PRJNA257944:JO41_07705 126 Ltw---------------------------------------gyPQVLQ---------------VGMPINIGFFCFFNKK 151 Trepo...
SLUandSVAtrep:TPE_0339 112 Miy---------------------------------------gyPQIIQ---------------AGIPVQLGFQYYFTEK 137 Trepo...
WP_021329094           155 Wgv---------------------------------------grLKPYSfeshgylpenmplvtFGIPVQAGAQFFFTKN 195 Trepo...
SLUandSVAtrep:TPE_0693 135 Ial---------------------------------------gqFWTNLnnqqle---nfyhawTPITLHLGVQYIFTKH 172 Trepo...
PRJNA257944:JO41_06440 149 Lal---------------------------------------grFWTRSngqgle---nfyhawTPIALHIGFQYIFTKH 186 Trepo...
WP_044014230           327 Lsa---------------------------------------siFGKSSfi------------sFTVPIDLDIKYYFTRS 355 Trepo...
O83696                 110 Icg---------------------------------------dsCATSEgkssaw----yskllYSVPLNLEVQYYLTSF 146 Trepo...
O83164                 127 Csatvddaqyepytkneq----------gttvasntvfpctvleALVRDpaltadyllygmqscYAIPLHVGVSYYLAKR 196 Trepo...
O83628                 157 CtaliydsqhflsvlgqgllqpssssysagnwhrprsllgvltcTAKEVgaiheesrikgvcqnYAVPVQLGVQHYFGAH 236 Trepo...
O83492                 145 I-------------------------------------------LSTQDdk------------lVGIPINLDFLIFFTKH 169 Trepo...
O83695                 123 I-------------------------------------------MSTKDk-------------iVGVPVNLDFHFFFTGV 146 Trepo...
O83366                 108 F-------------------------------------------LASHDh-------------aAGVALSLDFQYFFNDW 131 Trepo...
O83367                 168 WGFALSVSGGVDFPLNpntrflagklpaetvqrvalvalrqklisegiikaldlgwfitfaltvvaegfswivsqsawia 247 Trepo...
PRJNA257944:JO41_07705 152 SGLNITATDMVGIGFP---------------------------------------------------------------- 167 Trepo...
SLUandSVAtrep:TPE_0339 138 IGIDISAIDMIGIGFP---------------------------------------------------------------- 153 Trepo...
WP_021329094           196 IGINLMVTDALGFAVGnlgknsn--------------------------------------------------------- 218 Trepo...
SLUandSVAtrep:TPE_0693 173 LGITVGLYDMISFSgllrskekani------------------------------------------------------- 197 Trepo...
PRJNA257944:JO41_06440 187 IGINIGLHDMISFSgllrsmeksni------------------------------------------------------- 211 Trepo...
WP_044014230           356 VGISISGMGTFGIGsfitssempvds------------------------------------------------------ 381 Trepo...
O83696                 147 AGVAVAASTAVGVrdf---------------------------------------------------------------- 162 Trepo...
O83164                 197 WGIECALTASLGISMR---------------------------------------------------------------- 212 Trepo...
O83628                 237 WGIDATATVSFGIDTKl--------------------------------------------------------------- 253 Trepo...
O83492                 170 VGLDFTFGSGVNVPLTknlkkgangng----------------------------------------------------- 196 Trepo...
O83695                 147 VGLSVGVASGVGIPITanleqckngags---------------------------------------------------- 174 Trepo...
O83366                 132 VGLDLNIGAGVDVPVNsnlrylmrvgtpelakilithtvthglanrwisgp-------hwwnslsswvgntagkvagfva 204 Trepo...
O83367                 248 qkavnyflsdttRCLILPVTLRAGPTFRI 276 Treponema pallidum
PRJNA257944:JO41_07705 168 ------------SFLTNAFTVKIGPIFRL 184 Treponema sp. OMZ 838
SLUandSVAtrep:TPE_0339 154 ------------MFLTNSFTIKTGISFRL 170 Treponema pedis str. T A4
WP_021329094           219 ------ddrvysIGFSYMGTVKVGPVFKF 241 Treponema socranskii
SLUandSVAtrep:TPE_0693 198 --adgnnkvggtVGFGNVFTLRIAATFRL 224 Treponema pedis str. T A4
PRJNA257944:JO41_06440 212 --addnnkvgstFGFGNVFTLRIAAAFRL 238 Treponema sp. OMZ 838
WP_044014230           382 -asafflrasmfHPISMNFAVKIGPTIRI 409 Treponema sp. OMZ 838
O83696                 163 ----------nfKEFTLPLSLTIGPTFRV 181 Treponema pallidum subsp. pallidum str. Nichols
O83164                 213 ------------TDVRVPYAVRIGPVFRV 229 Treponema pallidum subsp. pallidum str. Nichols
O83628                 254 ------------AKFRIPYTLRVGPVFRT 270 Treponema pallidum subsp. pallidum str. Nichols
O83492                 197 -qdltwsniwakYCCTSLVMVKIGPVFRI 224 Treponema pallidum
O83695                 175 -tdlkweqflqkYCLECPLTVQIGPVFRV 202 Treponema pallidum
O83366                 205 rlianyllkgsqYSMLVPVVVRLGAVYKV 233 Treponema pallidum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap