Conserved Protein Domain Family
DUF2688

?
pfam10892: DUF2688 
Protein of unknown function (DUF2688)
Members in this family of proteins are annotated as KleB however currently no function is known.
Statistics
?
PSSM-Id: 371287
View PSSM: pfam10892
Aligned: 3 rows
Threshold Bit Score: 86.8742
Threshold Setting Gi: 820891426
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
jgi:Desru_0648  4 KKIQIVTTQCKRCGKSLVKTNRSLYGMEELKVKFGDICSDCMSNEELGEILRAQGT 59  Desulfotomaculum ruminis DSM 2154
WP_046797595    4 RKIEIVTTNCRRCGKSISTLSRSLIGADALRQELGGICGDCITPEERQRIEEGTLQ 59  Rhizobium sp. LC145
CAZ15860        4 KMAYVVSTHCRRCGTPLRTLRHSLLGLDDLKQRLGSICTACLIPEELAEIEQAQVE 59  Xanthomonas albilineans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap