Conserved Protein Domain Family
DUF2719

?
pfam10891: DUF2719 
Protein of unknown function (DUF2719)
This family of proteins with unknown function appears to be restricted to Nucleopolyhedrovirus.
Statistics
?
PSSM-Id: 151339
View PSSM: pfam10891
Aligned: 5 rows
Threshold Bit Score: 136.923
Threshold Setting Gi: 119964576
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
YP_950772  1 MLRSIMRRFKSTNNLSKKPSGhyVVLCPKCYFVTSSEVSVAEYVEMHKNFNMKFADRCPNDFIVTNSKSWNNYKNCSALY 80  Maruca vitrata nucl...
Q2NP17     1 MLRALKRRFKLADGERRREEN--VVLCPRCYFVAPGHIAVADYTRMHIKYNEQFADQCSNNFAVTQPKTWLNYTNCPALY 78  Hyphantria cunea nu...
Q7TLU0     1 MLRALKRRFMPASDERRREED--VVLCPKCYFVAPGRISVADYTRLHIKFNEQFADACSNTLVVTEPKTWSHYTNCSALY 78  Choristoneura fumif...
Q6VTT6     1 MFQALIRRFKKEKGEQNREQD--VVLCPRCYFVAPGYISVAEYTRMHIKFNEQFVDKCLNNLALEQPKTWANCSVCPALY 78  Choristoneura fumif...
Q91GK0     1 MLRALKRRFKSAGVAQHHEED--VVLCPRCYFVAPGTISVVDYTKLHIKFNEQFVDKCPNNFEVTQPKTWSNGALCSALY 78  Epiphyas postvittan...
YP_950772 81 YPL 83  Maruca vitrata nucleopolyhedrovirus
Q2NP17    79 YQL 81  Hyphantria cunea nucleopolyhedrovirus
Q7TLU0    79 YPL 81  Choristoneura fumiferana multiple nucleopolyhedrovirus
Q6VTT6    79 YPL 81  Choristoneura fumiferana DEF multiple nucleopolyhedrovirus
Q91GK0    79 YPL 81  Epiphyas postvittana nucleopolyhedrovirus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap