Conserved Protein Domain Family
DUF2748

?
pfam10871: DUF2748 
Protein of unknown function (DUF2748)
This is a bacterial family of proteins with unknown function.
Statistics
?
PSSM-Id: 402469
View PSSM: pfam10871
Aligned: 2 rows
Threshold Bit Score: 790.351
Threshold Setting Gi: 14424018
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_038601813   2 SNLYHILHAMPALDREEMPPQLEEVAKSLVLSGRLRIDANDKINFARLYLPYDGVSMMFSLRELTDIKLLGHTKKIITMV 81  Rickettsiales b...
Q9ZEB1         2 TSIYHILDRIPAIYKQDMEIEYEYLAMQLIKSGKLRIDTNDCCNFARFTDPALNINLMISKEELTKPHLIPETTKLFQSL 81  Rickettsia prow...
WP_038601813  82 LQKrhknQGLMDKVQQEVLKLRNEIKKYQPVSEKLEMSLARLVVQSVHPVVMLMLLWERVEIFISYSYTIGDVLDVVSWQ 161 Rickettsiales b...
Q9ZEB1        82 YKN----SASDQKINSIFDNLKKQIQKLQPVKKEVTEMLARLFVQSAHPIVIRWLLLNKTEVFLTYSHNIGDMMDIVSWQ 157 Rickettsia prow...
WP_038601813 162 YAGDNSGMQSTDGRMATIYISAGGNPFAE-TTEDAVYGDGFPAMARMMIIGAQEMGHYSDIMRDAHGRQISRYSANLNAT 240 Rickettsiales b...
Q9ZEB1       158 RVGGNSGMQSTNGKDVAIFVSCGGNPFAEnNKEHPSYGDGFAAVARLQIIAAQELGHFADIKRDDKGRQLTRHAANFSGT 237 Rickettsia prow...
WP_038601813 241 KAKENVRIGRLNDIKNLQLIRSMLIKFNVLRLAEHERHLKFFRKNKRRGITVLFTISKICFWRgCMMRKSRSKKFLGFVL 320 Rickettsiales b...
Q9ZEB1       238 KATDKVRIARKSDIIHCNNLFNKLLNAGMKKQLEYETKLKFYNTNKINGVKVNAIKCMILIYK-FRLLNYSSKNNLIFIR 316 Rickettsia prow...
WP_038601813 321 FWKKEKYLASRIIAMLDDMEFNLTPKADAYSRANKVEEEAIACVEALARVPQQVVKWGANLTKIIWPNLYSIYYKEVIPG 400 Rickettsiales b...
Q9ZEB1       317 KFKTYKYMALMLEAMFKDMQDNLSPNAEVYKNKNPEIEEAIACIEALARVPQQTIKWGYLTTKETMHHLYKIYYNEVIPS 396 Rickettsia prow...
WP_038601813 401 CMVAYKNMTGKDYNLKLTTPGFHPLYRLKRlFRKKIKKY 439 Rickettsiales bacterium Ac37b
Q9ZEB1       397 LITSYNSFTGENYKRNLKKPKSSFFSKINI-FSNKKLIL 434 Rickettsia prowazekii str. Madrid E
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap