Conserved Protein Domain Family
DUF2663

?
pfam10864: DUF2663 
Protein of unknown function (DUF2663)
Some members in this family of proteins are annotated as YpbF however currently no function is known.
Statistics
?
PSSM-Id: 371275
View PSSM: pfam10864
Aligned: 12 rows
Threshold Bit Score: 131.295
Threshold Setting Gi: 81366252
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
PRJNA212797:N288_17205  19 MLQKVVERKRKFDKYKARHLAVMWAGVFVSFFYLIYLyytvmepySYSF---ASMFSAFASSSANLYLLFLAGGLYGTMN 95  Bacil...
Q9KCG1                  21 MIEELIVRKEKWDKLEKQLRFWSVLGLAFLLLGIIHVivl---ttSTHT---TYLLQLISGNQTFLFVLLGVALSFFQMQ 94  Bacil...
jgi:Bcell_1835          11 IIKALIEAKEKEEIAEKKMMKYGSLFLTVLLAGFIYIvik--lttGEAI---SSYLSFILADPIILLWIVAVFVAFYFFD 85  Bacil...
Q5WGX1                  10 ITKELIKRKAEWDRLEKQHLFCGWAALISGCTFVILLne-----pQTGR---TVFPKALLASPLSTTLLVVLFLSLIGLV 81  Bacil...
WP_012958454            21 MLEEMIARKEKWEKLNKAKNHWSLFTLLSLGLFLLFGaqv--lrgSSGLhfsSNFLSILVGNTILLLLILLFIVGIVQVK 98  Bacil...
P50732                  19 MLQALVKRKQKFENYAAQCRRWRWASLICLGLLCVMImi-----kSPEP---QLILQEILSHTFYLFWMLATAFAYCTSY 90  Bacil...
Q62TE6                  19 MLRALIKRKKKYENYARQTFRWQAVAAICAVSFCVFAas-----kGIGQ---NGFLSGLLNDSVYLLWILSAAFAYSTAY 90  Bacil...
WP_014098134            18 MLQSAVKRKKKFDRLRKRHLVFLWTSMLYTCAWAYYVyrs--fenAGSV---FSVFSGISESPFHLFFLLVAAALWGMSK 92  Bacil...
jgi:B1NLA3E_14955       19 MLQNVVKRKKKYDQYKAKHLFTMSCTLFLLFCYFIYLyftvvnpySYSF---SVMFSAYVNNSANFYFLIITLGTYGLMN 95  Bacil...
MA:Aflv_1062            16 ILQRIMTHKREWEDMKKRMKWSFILFLFSLTLFGLYIyqtvvipnHSST---ERMVVAAIDDERIFWFTAFVGSLGWFVS 92  Anoxy...
Q5KXR1                  17 MLMAVIEKKKKWERLEKRTLLLQAAAFSGLAVFLLYLlak--aaaFGTW---GERIAWFFAAPAHVLILLLLSTVYWAAV 91  Geoba...
WP_015864321            18 MLLGVIEKKQKWERLKKRVLSLQIVTLGGFAVFFVYVlfyl-ifpSGTL---TAFIKMFLEKTVHLYILLLLFTLYWAIL 93  Bacil...
PRJNA212797:N288_17205  96 LFKEKKDKAEKEYHALRCEIVDRSKDLWKKEEEWKNRHIVFEMMKKNYDINLYHE 150 Bacillus infantis NRRL B-14911
Q9KCG1                  95 FVHKKAEKAETEYEELRKELVERSVELWDTEPLWQKRNETFQHLKDTFNINLYYK 149 Bacillus halodurans
jgi:Bcell_1835          86 ARSKKYEKAEKDFDALKEDVIDRSSDIWSSNDLEMKRIAQYHELKNKYNINLYHK 140 Bacillus cellulosilyticus DSM ...
Q5WGX1                  82 YLSKKAAKKEKEFEALRNEFIERSEEFWPAERSAAEKEAYLKEMQTRYSINLFYf 136 Bacillus clausii KSM-K16
WP_012958454            99 LLSKKATKAEIEFEALREECIERSSELWEKDQSWQHRESVFTYMKTEHDINLYHK 153 Bacillus pseudofirmus
P50732                  91 YFKKKEEKSETDFHKLRCEIIQKSTDLWPQPDKWKARESVFHMMKHKYDINLYFE 145 Bacillus subtilis subsp. subti...
Q62TE6                  91 YFKKKEEKAEGEYHKLRCEIIQKSTDLWPQPEEWKSRETVFKIMKQQYDINLYFE 145 Bacillus licheniformis DSM 13 ...
WP_014098134            93 ILFDKREKAEKEFHALRCEIIDKSKDLWKG-ESWKDRHLVFEMMQKEFDINLYHE 146 Bacillus coagulans
jgi:B1NLA3E_14955       96 IFREKKEKAEKEFHALRCEIIDKSKDLWKKEESWTSRHLVFEMMKKTFDINLYHE 150 Bacillus sp. 1NLA3E
MA:Aflv_1062            93 FYKKKSDKAEQDFHALRCEFIQKSSELLEK-RAWEKRHVLYEWMKETYDISLYHE 146 Anoxybacillus flavithermus WK1
Q5KXR1                  92 YYKGKSEKAEDDFHALRCEIIQKSIDLWQDQEQWNGRHRLFEWMKREYGINLYYE 146 Geobacillus kaustophilus
WP_015864321            94 YYKKKCDKAEEEFHSLRCEIIQKSADLWKEEQQWKERHKLFEIMKKEYDINLYYE 148 Bacillaceae
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap