Conserved Protein Domain Family
DUF2659

?
pfam10858: DUF2659 
Protein of unknown function (DUF2659)
This bacterial family of proteins has no known function.
Statistics
?
PSSM-Id: 402462
View PSSM: pfam10858
Aligned: 2 rows
Threshold Bit Score: 354.033
Threshold Setting Gi: 799032053
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011944906   1 MADILQEIKDSDRYQRCLLYYKKFLLIVFSSSLFITAAMMINNFYNARQEAYYQKITDIFIESIDQDSNNSDLIVQSLEK 80  Orientia tsutsu...
WP_045917793   1 MADILQEIKDSDRYQRCLLYYKKFLLIVFSSSLFITAAMMINNFYNARQEAYYQKITDIFIESIDQDSNNSELIVKSLEK 80  Orientia tsutsu...
WP_011944906  81 FLLSNYNTKVQELAHIQLLAHKIKVGSFTEVKQLANEILAMKSYSNFTKAYVRLNLLAMAIDVKQNDDnNSNYDSQIKLI 160 Orientia tsutsu...
WP_045917793  81 FLLSNYNTKVQELAHIQLLAHKIKVSSFTEVKQLANEILAIKNYSDFTKAYVRLNLLAMAIDVKQNDD-NSNYDSQTQLI 159 Orientia tsutsu...
WP_011944906 161 EQLFSEFSPSMPFWSIASIYYAIWAHENGDDNKAVQYLEAVIRSKYSSWNLKSQAKMLKQNYEI 224 Orientia tsutsugamushi
WP_045917793 160 EQLFSEFSPSMPFWSIASIYYAIWAHENGDDNKAIQYLEAVIKSKYSSWNLKSQAKMLKQNYEI 223 Orientia tsutsugamushi
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap