Conserved Protein Domain Family
DUF2650

?
pfam10853: DUF2650 
Protein of unknown function (DUF2650)
This family of proteins with unknown function appear to be restricted to Caenorhabditis elegans.
Statistics
?
PSSM-Id: 402460
View PSSM: pfam10853
Aligned: 16 rows
Threshold Bit Score: 45.3601
Threshold Setting Gi: 308258495
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CAP22261  60 CPQASAFHQFDCCGQHETECCFAIQGWVIVILIIV 94  Caenorhabditis briggsae
PDM81425  49 CPHATEFYYFSCCGDFNKDCCLELQDWITTSLLLI 83  Pristionchus pacificus
EFO85351  57 CPEENVFWYFKCCGQIADQCCFRLQDWVTVLLLFL 91  Caenorhabditis remanei
CAP32049  60 CGSTSFAHYYNCCGDNNAECCFALQIWVYITLAVL 94  Caenorhabditis briggsae
EFP02448  40 CGADNIFYRWRCCDYSPYECCIQLETWVVVFLVIF 74  Caenorhabditis remanei
CAS00965  43 CPTDSFIHYYSCCDDNPFQCCFHFETWAIVIFGIV 77  Caenorhabditis briggsae
Q27GU6    84 CPKDSKWVYYTCCGGANMYCCEHIQTWLLSFLAVI 118 Caenorhabditis elegans
EGT48367  69 CPKETNWVYYTCCGGANMYCCEHIKTWLLSVLAFI 103 Caenorhabditis brenneri
EFO16892  71 CPNNNIFVFYQCCENVPKECCWHIRYWLTIVLILV 105 eye worm
OZC05517   1 CPDESIFHYYYCCYGLLGACCFYLRTWLIILLMVI 35  Onchocerca flexuosa
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap