Conserved Protein Domain Family
DUF2652

?
pfam10851: DUF2652 
Protein of unknown function (DUF2652)
This family of proteins has no known function.
Statistics
?
PSSM-Id: 402459
View PSSM: pfam10851
Aligned: 11 rows
Threshold Bit Score: 164.417
Threshold Setting Gi: 504553367
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
jgi:Cycma_4441    39 ITELIELIIKETGDEFSVSEIEGDAVLFFN----NNSLPDFEKLTSLCITIFKKFHQHLKYYARDRICHCGACNSTEKLS 114 Cyclobacter...
EAR02503          30 IAELLEVLISANTQDLQLAEVEGDALFFYK----EEELTSQERLLAQMDAMFTAFYGHLKLLEKNRICPCNACATAHKLD 105 Maribacter ...
WP_015812732      31 IQELLETLVNANQIGLEISEIEGDAILFFK----FGQAPQLEVLYRQVEKMFCDFHKYLIAYDNRRFCQCKACISAVNLT 106 Dyadobacter...
WP_012789796      31 IQQLLEVLINANQAGFEISEIEGDAILFYK----FGAPLELEVLYKQVERMFCEFHRHLNAYDQRKICQCHACVAAVNLT 106 Chitinophag...
WP_014740469      34 trRLLDKIVGAAR-GFDLIEIEGDAAFLSRdasgMDGAATLSAVTGAAVAMHRAFHTQRRLVELNL-CPCQSCTQTSALK 111 Modestobact...
mpitm:STAUR_1479  34 VAQLLEVVIDAAG-GLKLAKLEGDAAFFYA----LGEDFTA--FARQAANIRRAFIAKKEQLIIDRMCKCGGCMQVGALT 106 Stigmatella...
Q1DBS3            34 VAQLLEAVIDASG-PLKLAKLEGDAAFFYA----VGDDFPA--FARMVADIRRAFVSRREQFIADRMCKCDGCMQVSSLT 106 Myxococcus ...
P9WL99             1 MAQLLESVIDAAK-GMKLAKLEGDAAFFWA----PGGNTSV-LVCDRPPQMRQRFRTRREQIKKDHPCDCKSCEQRDNLS 74  Mycobacteri...
Q73YA0            34 VAGLLESVINAGK-GLKLAKLEGDAAFFWA----PDSSAKV-VVCERLSRMRTSFLQRRERMKNDIACQCASCAQLEQLS 107 Mycobacteri...
WP_012393250      34 VAELLEAVIDAGK-GLKLAKLEGDAAFFWA----PGGDAKV-VVCERIAAMRQAFMERRERIKKDISCDCKSCAQLDDLS 107 Mycobacteri...
WP_052346656      54 VADLLEILIEANTLDLEVNEIQGDAVLFYR----LGPPPTAEELVRQCRRIYLDFQNYLRLVERDTGSALAASLHELALT 129 Hymenobacte...
jgi:Cycma_4441   115 LKFILHSGTITQFEVGGHQKLLGEDVIVAHRFLKNRIDQSEY 156 Cyclobacterium marinum DSM 745
EAR02503         106 LKIVAHSGELQFIHVQGNRKPFGQQVIEAHRLLKNSIDSDNY 147 Maribacter sp. HTCC2170
WP_015812732     107 LKVVAHYGEFTTYQVKNFKKLIGKDIIVAHQLLKNDIDQHEY 148 Dyadobacter fermentans
WP_012789796     107 LKVITHYGEFTTYQVKNFSKLIGKDVIVAHQLLKNDIAEHEY 148 Chitinophaga pinensis
WP_014740469     112 LKFVAHVGDVATQTIRRRKKLVGVDVIYVHRLLKNAVTVPEY 153 Modestobacter marinus
mpitm:STAUR_1479 107 LKFVIHSGEIAFQKVKRYTELAGVDVILVHRMLKNEVPLAEY 148 Stigmatella aurantiaca DW4/3-1
Q1DBS3           107 LKFVAHAGEVAFQRVKHLTELAGVDVILVHRMLKNDVPVTEY 148 Myxococcus xanthus DK 1622
P9WL99            75 IKFVAHEGEVAEQKVKRNVELAGVDVILVHRMLKNEVPVSEY 116 Mycobacterium tuberculosis H37Rv
Q73YA0           108 LKFVVHVGEVADQRVKRHVELAGFDVILVHRMLKNLVPVAEY 149 Mycobacterium avium subsp. paratuberculosis
WP_012393250     108 LKFVAHEGEVAEQKVKRRLELAGVDVILVHRMLKNSVPVSEY 149 Mycobacterium marinum
WP_052346656     130 LKIVVHYGRVSVARIREHTKLMGRDVIVVHRLLKNNVAGSEY 171 Hymenobacter swuensis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap