Conserved Protein Domain Family
DUF2656

?
pfam10847: DUF2656 
Protein of unknown function (DUF2656)
This bacterial family of proteins has no known function.
Statistics
?
PSSM-Id: 402458
View PSSM: pfam10847
Aligned: 9 rows
Threshold Bit Score: 176.088
Threshold Setting Gi: 500457900
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
ASGPB:GKIL_3405    9 RMLLSHNFDLEPGGIPVLSSAQFASVFIDGL-ASQPGIRCRYLEDSPHWLVEVLFAAdTHPPARVGELCAQALADRRQQQ 87  Gloeobacter...
Q7NCN1             8 RMLLSHNFDTSTAAVEALSPAQFAQIFTEGL-AAYPDLQCRCLEDSPHWLVEIYFPI-AFTPRQVGELCGRTLAKNRAGE 85  Gloeobacter...
CAK28958           3 VFVLSHNLQLSSAEVPAIA----ASELADGLlKASDHIQNSEALNHPHWLVKI---EsNLSAQELAQELIQAWEKYRKTC 75  Synechococc...
WP_011932404       3 TFVLSHNLQVNDSAVPALA----FDVLTAGLqTHCPSVTAAEALSHPHWKVKL---EsTASPDALARELVQGWRRVREGL 75  Synechococc...
WP_015174901       8 RMLLSHNFDMPEGVFPTLSREEFTLVFAEGL-SQYPEIKCRQL-NHPHWMVEVLFSTdAFSPPQVGEFCAQSLVDKRMSQ 85  Oscillatori...
jgi:Cha6605_4062   8 RMLLSHNFDITDGRLAGLSREEFTEVFRIGT-SDDTRIQCRSI-AHPHWIVEILFDR-ALDPQAVGAECARILAQYRQQ- 83  Chamaesipho...
WP_015196247       1 -MLLSHNFNVSEDVLPSLSREEFTKVFIQGL-ANIA--QCRLI-DNPHWIVEVLFDPnKFSAAQIGESCAQALINERLSQ 75  Calothrix p...
ASGPB:GKIL_1582    1 -MLLSHSFDIPEEIVVRLRPEAIARIFIDSL-SLFADIDCRFLENSPYWLLEILFPIaEISPEQIGQLCAKALVQRRTEQ 78  Gloeobacter...
Q7NM18            31 RMLLSHSFDIPEGIVPWLGTDEIAAAFLGAL-GSYSGLVCRSLDHSPYWMLEIRFSCaVLPPRRIGEACARALIQKRHQL 109 Gloeobacter...
ASGPB:GKIL_3405   88 LPEGVAPPDILALGGLKTTP-ARSASPYSLQPGNWGVDVVETASAETFLLAIGWEATVARLPA 149 Gloeobacter kilaueensis JS1
Q7NCN1            86 RKGEGRLPDTLILGGLKTTP-ALGNAPYSLRPGEWGVDVVETDAAEAFLTAIGWEATVAGRPT 147 Gloeobacter violaceus
CAK28958          76 --GHPMTHSLLALGGRKDSQaASSSAP--LQEGCWGVDVVECTDPDTFMHAINWNALKSGRPQ 134 Synechococcus sp. RCC307
WP_011932404      76 --GHGHAHAVMALGGRKDSE-GNPGAP--LQQGGWGVDVVETADAQGFLAAINWTGLTAGRPA 133 Synechococcus sp. WH 7803
WP_015174901      86 GKTDEFFPDILILAGLKKTP-PLSSDADALQTGEWGVDVVETQSAESFLMAMGWEEKTAGKSi 147 Oscillatoria nigro-viridis
jgi:Cha6605_4062  84 --DARNRADILILGGIKTTP-PTSPDPDALQPGQWGVDVVETVNGDLFLTKIDWDATIAQKPA 143 Chamaesiphon minutus PCC 6605
WP_015196247      76 VKDGQSLPNLLILGGIKTTP-PTSASPDALQPGEWGVDVVETANGNEFLQAIGWDATVASKPp 137 Calothrix parietina
ASGPB:GKIL_1582   79 QAGGWLRSDVLVLGVLRTNP-TRSSSPDALQPGNWGVDIVETASSEQFLKAIGWEAKIAQQPA 140 Gloeobacter kilaueensis JS1
Q7NM18           110 QPQQWLHPTVLVYGAKKTSP-ARSTSPDALQLGDWGVNVVETASAAKLLQAIDKESNLSQKPA 171 Gloeobacter violaceus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap