Conserved Protein Domain Family
DUF2642

?
pfam10842: DUF2642 
Protein of unknown function (DUF2642)
This family of proteins with unknown function appear to be restricted to Bacillus spp.
Statistics
?
PSSM-Id: 402456
View PSSM: pfam10842
Aligned: 15 rows
Threshold Bit Score: 75.3625
Threshold Setting Gi: 502569880
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_012818411            47 YATLVEPVFIDHLLRHKGAKVVIMTTAGKV-EGILSGVVVDHVQLTIGdNKALHIRLAEVVYF 108 Paenibacillus
BAK15920                 4 MNAYPNAYWLEAIQNYLGQMVAVQQEGNRVqQGILAAICPDYIVLDVC-QTPFYIRIDKIVSI 65  Solibacillus silvestri...
BAH43568                19 MNSFIEPYLYQTLQSVIRREVAIQTTQGNV-RGIVVDVLPDHVVLQMG-GSTFFVRIQQIVWV 79  Brevibacillus brevis N...
WP_012959214            12 MISSVDPYVVQTLQSVTGSEVVIETTRGNV-RGTVANVLPDHVVIESS-NSTFFVRIQQIVWI 72  Bacillus pseudofirmus
WP_012575002             5 FMSFIDPYVYQTLQTIRGKEVVIETVRGNV-HGTVEDVKPDHIVLKSN-DTLFFVRIQQIVWI 65  Anoxybacillus flavithe...
Q5KVG4                  14 LIALVDPYVYHAFQALNGKEVVVETVRGSI-QGTVRDVKPDHIVISAH-QAVYYIRLAQVVSV 74  Geobacillus kaustophilus
PRJNA212797:N288_16225  24 PVFHFDPYVYQTLQSVLGRNLVVETVKDTL-RGRLMDVKPDHIAVKSG-DEIFFIRIAQIVTI 84  Bacillus infantis NRRL...
O32097                   9 LVSLVDPYVYQTIKKLIGSRFVIQTVRDTV-RGRLIDVKPDHITIEGArNSVCLIRIQHMISV 70  Bacillus subtilis subs...
ABV63506                 9 LVSLVDPYVYQTLQKVVGMRLIVQTVKDTV-RGKLKEVMPDHIVIEAGaKSVFYVRIQQIVSV 70  Bacillus pumilus SAFR-032
Q9KAN6                  11 MISSVEPFLFQTLQSTLGRHVVIQTTKGSM-RGRLTDVKPDHLTLQME-DATFLIRTQEIVWV 71  Bacillus halodurans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap