Conserved Protein Domain Family
DUF2572

?
pfam10833: DUF2572 
Protein of unknown function (DUF2572)
This bacterial family of proteins has no known function.
Statistics
?
PSSM-Id: 402454
View PSSM: pfam10833
Aligned: 5 rows
Threshold Bit Score: 332.161
Threshold Setting Gi: 168825758
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
jgi:HSM_0139    5 KGVVTLTLLMLLSSVLLILLFFDGDLISLHSSIVSQRKIYLEQSLILQRQSISQKEKLCEN----QPLNNNLKSLKIEFE 80  Histophilus so...
Q65UM7          6 RGFATLMIVFIIAGLAVSTMLFTDDQLHYHRGIMAQRSAYVSQMAQLQNLAIEQMPVICQQipdgLPDNTTSYTLPISLS 85  [Mannheimia] s...
P44081          5 KGIITLTILIFISGLLTAFLLLDDSHLSFFRAQQNQRKHYVERTLQLQKMTATKKQTACLD----LPLNNNESVKQISIA 80  Haemophilus in...
Q9CM74          5 KGMVTFVILVLLSSGLTILMLLNDDILHWHLSALHQRKLDVQQMLVLQRQNEEKKQHLCKH----ISSTSSENRQQVTFR 80  Pasteurella mu...
jgi:Asuc_1787   7 RGIMTLTLLMLLSVMLLIFMLFDDDAIRLHSSLASLRQIYVSHNIELQQISQQQKRTACSE----VPLNSTATVTRVAFE 82  Actinobacillus...
jgi:HSM_0139   81 SRRKIDR---TSQFIWCERKYLFKKRPKKATYeaGLSQYINLELLDLFQHKLHSPPAILPRDKANYLYWVEEKSAELEIQ 157 Histophilus so...
Q65UM7         86 TASSNKSaveISHFLRCRRYSLLATKPTKKFE--SYSTAVNEENIELFRHRFNQSYINEDTGQKVFLYWLDETTESLILS 163 [Mannheimia] s...
P44081         81 LEGSTDA---IQYFLWCERMSLFKKSPKKGDNqgALKDFVTDEKLAYFRPHFSSPPRILNANKMPKLYWFSDSQAEVEIN 157 Haemophilus in...
Q9CM74         81 ---LVEG---KANYVWCICRTLFKAQPRQALNigKLAYFIQREYRGLFSHQFSV-------QHAPYFYWFDTKQTSWTLT 147 Pasteurella mu...
jgi:Asuc_1787  83 QAGFSDS---NRHYIWCRRSALFKQSPKKGINegRFSEMINEESVSLFQGKFGLP-NDLVQEQSDYLYWLDKNQTEWTIA 158 Actinobacillus...
jgi:HSM_0139  158 GNINAVVIAEGDLKLTGKGKISGTVITGGKLSIEpAVKIVYRSKTIIDLIRSYSYWQFAENSWYDFQ 224 Histophilus somni 2336
Q65UM7        164 GDTNAVVIAKEPLKIEGKGRLRGVVISDYPVELE-GVQLSYNKYVMDFIYREFSLWKLAERSWSDFD 229 [Mannheimia] succiniciprodu...
P44081        158 GTVSAVLIAEGDLKLTGKGRISGAVITSGNLTLD-GVTLAYGKKTVVALVQQYSQWQLAEKSWSDFN 223 Haemophilus influenzae Rd KW20
Q9CM74        148 QNIEAIIIAEGDLHIHGKGKIKGTIVTGGRLTLEpSVQVSYHKATVAYWVTQLRDWQLAEKSWHDFL 214 Pasteurella multocida
jgi:Asuc_1787 159 GDIYGIIVAEGNLHIAGKGRIRGAVISGGAISTDeKVSIAYRKATVTNLVQLYSQWQRAEKTWHDFT 225 Actinobacillus succinogenes...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap