Conserved Protein Domain Family
DUF2556

?
pfam10831: DUF2556 
Protein of unknown function (DUF2556)
This family of proteins with unknown function appears to be restricted to Enterobacteriaceae.
Statistics
?
PSSM-Id: 402452
View PSSM: pfam10831
Aligned: 3 rows
Threshold Bit Score: 86.8145
Threshold Setting Gi: 745783973
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
OHY58540      1 MLRKYGWLIAFALLMFLFEGIVMHLIEVLTTEYDKCRNMDSVNPLKLVKCSDL 53  Pluralibacter gergoviae
WP_032950338  1 MIRKYWWLVVFAVFIFLFDALLIQWIELMTTEHDKCRNMNSVNPLKLVNCVDL 53  Citrobacter
WP_039077398  1 MIRKYFWLVIFALSVLLLDALIMQWIEFLTTEVDKCRNMDSVNPLKLVNCADL 53  Enterobacterales
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap